KEGG   Macrococcus sp. IME1552: BHM04_06480
Entry
BHM04_06480       CDS       T05070                                 

Definition
(GenBank) CoA-disulfide reductase
  KO
K08255  CoA-disulfide reductase [EC:1.8.1.14]
Organism
macr  Macrococcus sp. IME1552
Brite
KEGG Orthology (KO) [BR:macr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHM04_06480
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.14  CoA-disulfide reductase
     BHM04_06480
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO NAD_binding_8 Pyr_redox_dim NAD_binding_7 K_oxygenase TrkA_N ApbA Shikimate_DH Sacchrp_dh_NADP AlaDh_PNT_C 3HCDH_N UDPG_MGDP_dh_N FAD_binding_3 2-Hacid_dh_C Cas_Cas1 Amino_oxidase
Other DBs
NCBI-ProteinID: ATD30856
LinkDB
Position
1252288..1253607
AA seq 439 aa
MKVIVIGAVAGGATVASQLRRLSDAEITVYEKDRDMSFANCGLPYYLGGEVAPRNKLIAA
TESSFKTNKSITVKTYHEVVSVSAENKEIVVKDIKNDRTFTDTFDYLILSPGATQIKLPV
LQGNHVFTLRNLEDTDKIERFITSENVKNILIIGGGYIGLEVIENLKNRGINITLLHRSS
HLLKSVDADMTKHIPEILEANGVELLLNDEVDTLEGKTVHLKSGREFNFDMIITALGIKP
NTQFIQSSGIKLTDSGHIKVNEYFETNISYIYALGDAIQTKYRHVDYPAQIALAWGAHRA
ANIIAHNIVKSQSVQFKGLLGTNIIRLFDFTFASVGITPNMLDNFEYEIVQQTQKHHAGY
MPGVEQISINVYYDKKSRKILRASAFGRVGVDKRIDIIATAMIGNLTIDEFKDIEIAYSP
VYSSPKDIINMLGYKAEQK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaaggttattgttataggcgcagtagcaggcggtgctactgtagcctctcaactcaga
agattaagtgacgcagaaattactgtatatgaaaaagatcgtgatatgagttttgccaac
tgtggtttaccttattatttaggtggtgaagttgcacctcgcaataagctgattgctgca
actgaatcttcatttaagacgaataaatcaattactgtgaaaacataccatgaagttgtt
tcagtatcagctgaaaataaggagattgttgtaaaagatattaaaaatgatcgtactttt
actgatacatttgattatttaatcttatcacctggtgcaactcaaattaaattaccagta
ttacaaggaaatcatgtatttacgctccgtaatttagaagatactgataagatcgaaagg
tttatcacttctgaaaatgtgaaaaatattctgatcatcggtggaggatacatcggttta
gaagtcatcgaaaatttaaaaaatcgcggcataaatattacattgttacatcgcagttca
catctacttaaatctgtcgatgcagatatgacaaaacatataccagaaatacttgaagct
aacggtgtagaattattattaaatgatgaagtagatacgctagaaggcaaaactgtgcat
ctaaaatcaggtcgcgaatttaattttgatatgattattacagcgcttggcattaaaccc
aatacacaatttatacagtctagtggcataaaattaacagatagcggacatattaaagtt
aatgaatattttgaaacgaatatctcttatatctatgctttaggtgatgctatccagacg
aaatatcgacatgttgattatccagctcaaatagcacttgcctggggtgcgcatcgtgcg
gcaaacattattgcgcataatatagtaaaatcccagtctgtacagtttaaaggattacta
ggtacaaatatcattagattatttgattttacatttgcaagtgtgggtattacaccgaat
atgctggataacttcgaatatgaaattgttcaacaaacacaaaagcatcatgctggttat
atgccaggtgtagaacaaatttcaatcaatgtctattacgataagaaatctcgcaaaata
ttacgcgcttcagcctttggcagagtcggtgtagataaacgcatcgatataatagctaca
gctatgatcggaaatttgacgatagatgaatttaaagatatcgaaatcgcatatagcccc
gtatatagtagtccaaaagatattatcaatatgctcggctataaagcagaacaaaaataa

DBGET integrated database retrieval system