KEGG   Macrococcus sp. IME1552: BHM04_06960
Entry
BHM04_06960       CDS       T05070                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BHM04_06960
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BHM04_06960
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored DAO Thi4 GIDA FAD_binding_2 HI0933_like NAD_binding_8 FAD_binding_3 K_oxygenase NAD_binding_7 Lycopene_cycl Trp_halogenase
Other DBs
NCBI-ProteinID: ATD30941
LinkDB
Position
complement(1341413..1342339)
AA seq 308 aa
MTEIKEYDVVIVGAGPAGMTAAVYASRANLSTIMIERGMPGGQMANTADVENFPGFDLIT
GPDLSTKMFNHAQKFGAEYAYGDIKSVTLDGDMKIIDLGEKQLKAKALIIATGAEYKKIG
VPGEQELGGRGVSYCAVCDGAFFKQKHLIVIGGGDSAVEEGVYLTKYADKVTIVHRRDKL
RAQKILQDRAFKNEKVDFIWNSTLKSINGDTKVSSVTLVDNDGVESTVPTDGVFVYIGMQ
PLTKPFLDLGITDEVGYIITNDEMETSIPGIYAAGDVRVKKLRQIVTATGDGSIAAQNAQ
HYIESLND
NT seq 927 nt   +upstreamnt  +downstreamnt
atgactgaaataaaagaatatgatgtagtaatcgttggtgctggtcctgcaggaatgact
gcagcagtttatgcatcgcgtgctaatctatcaacaattatgattgaacgtggtatgcca
ggtggacaaatggcaaacacagcagatgtagaaaactttccgggatttgatttaatcact
ggaccagatttatctacaaaaatgtttaaccatgcgcagaaatttggtgctgaatatgca
tatggagatattaaatctgtaacattagacggagatatgaaaattatcgatctaggtgaa
aaacaattaaaagcaaaagcattaatcatagcaactggtgctgaatataaaaagattggt
gtacctggtgaacaggaattaggtggccgaggcgtttcatattgtgctgtatgtgacggg
gcgttctttaaacagaaacacttaatcgttatcggtggtggagattctgcagttgaagaa
ggtgtatacttaactaagtatgcagacaaagttacaatcgtccatcgtagagataaatta
agagcacaaaaaatcttacaggaccgtgcctttaaaaatgaaaaggttgatttcatctgg
aattcaacattaaaatcaattaacggagatactaaagtgagttctgtaacgttagttgat
aatgatggtgttgaatcaactgtaccaactgacggtgtgttcgtatatattggtatgcag
ccattaacgaaaccattcttagatttaggtattactgatgaagtaggttacattattaca
aatgatgaaatggaaacaagtattcctggcatttatgctgcaggagatgtacgtgttaaa
aaattaagacaaatagttactgcaacaggtgatggtagtattgctgcacaaaatgcacaa
cactatattgaatctttaaacgactaa

DBGET integrated database retrieval system