KEGG   Macrococcus sp. IME1552: BHM04_07695Help
Entry
BHM04_07695       CDS       T05070                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00010  Glycolysis / Gluconeogenesis
macr00071  Fatty acid degradation
macr00280  Valine, leucine and isoleucine degradation
macr00310  Lysine degradation
macr00330  Arginine and proline metabolism
macr00340  Histidine metabolism
macr00380  Tryptophan metabolism
macr00410  beta-Alanine metabolism
macr00561  Glycerolipid metabolism
macr00620  Pyruvate metabolism
macr00625  Chloroalkane and chloroalkene degradation
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:macr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHM04_07695
   00053 Ascorbate and aldarate metabolism
    BHM04_07695
   00620 Pyruvate metabolism
    BHM04_07695
  Lipid metabolism
   00071 Fatty acid degradation
    BHM04_07695
   00561 Glycerolipid metabolism
    BHM04_07695
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BHM04_07695
   00310 Lysine degradation
    BHM04_07695
   00330 Arginine and proline metabolism
    BHM04_07695
   00340 Histidine metabolism
    BHM04_07695
   00380 Tryptophan metabolism
    BHM04_07695
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BHM04_07695
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BHM04_07695
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BHM04_07695
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BHM04_07695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ATD31076
UniProt: A0A290UXG6
LinkDB All DBs
Position
1490811..1492289
Genome map
AA seq 492 aa AA seqDB search
MSNILKEQYGLFINGEFVDAENKETLEVKSPATGEVLAKIAKATTGDVDKAVKAAGEAFK
TWRYSTNTERAALLNKIADIMYENKDDLAMIESINSGKAIRESANIDIPMAADHFRYFAG
VIMADEGTSKDLAENTLSIIRHEPIGVVGAVVAWNFPMLLASWKLAPALAAGNTVVIQPS
SSTPLSLLHLAELIKDVLPKGVLNILSGKGSESGDAIFNHEDVAKVSFTGSTEVGYGVAK
AAAERLVPATLELGGKSANIIFDDANIEQAIEGAQLGILFNQGEVCSAGSRLYVQEGIYD
EFVGKLKEAFETINVGDPLDPNNHYGSQTGQAQIDKIEEYIEIAKQEGLNIVTGGERLMD
NGRDKGFFFPPTIIEFDDNKSRLVQEEIFGPVVVVSKFKTQEEVIEKANDSIYGLAGGIF
TSNINRALQVANQMDTGRIWINTYNQIQAGSPFGGYKKSGIGRETYKETLRHYQQVKNLY
IDYSDAAKGIYK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatattaaaagaacaatatggtttatttattaacggagaatttgttgatgca
gaaaacaaagaaacgttagaagttaagagtcctgcaacaggtgaagtattagcgaagata
gcaaaagcaactacaggtgatgtagataaagctgtcaaagcagctggtgaagcttttaaa
acatggagatattcaacaaatacagaacgtgctgctttattaaataagattgcagatatt
atgtatgaaaataaagatgatttagcaatgattgaatctataaactcaggtaaagcaatc
cgtgaatcagctaatattgatattccaatggctgcggatcacttccgctactttgccggc
gtaatcatggctgatgaaggaacgagtaaagacttagctgaaaatacattaagtattatt
cgtcatgaacctatcggtgtcgttggggcagtagtagcatggaacttcccgatgttactt
gcatcctggaaactagcacctgcattagctgctggtaacactgttgttattcagccttca
tcatctactccactttctttattacatttagcagagttaatcaaagatgtattacctaaa
ggtgtattaaacatattaagtggtaaaggttcagaatctggagatgcaatcttcaatcat
gaagacgttgcaaaagtttcatttacaggatctactgaagttggatacggtgtagcgaaa
gctgcagctgaacgtttagtaccagcaacgttagagttaggtggtaaatcagcgaacatt
atttttgatgacgctaatatcgaacaagcaatcgaaggtgcacaattaggtattttattt
aaccaaggtgaagtatgttcagctggttcaagactttatgttcaagaaggcatctatgat
gaatttgtcggtaaattaaaagaagcttttgagacaatcaatgtaggtgatccattagat
ccaaacaatcactacggttctcaaactggacaagctcaaatcgataaaatcgaagaatac
attgaaattgcgaaacaagaaggattaaacatcgttactggtggagaacgcttaatggac
aacggacgcgataaaggattcttcttcccaccaacaattattgaattcgatgacaacaaa
tctcgtttagttcaagaagaaatctttggaccggtcgttgttgtttctaaattcaaaaca
caagaagaagtaattgagaaagctaatgattcaatctacggtttagctggtggtatcttc
acttctaacattaaccgtgcgttacaagtagctaatcaaatggatacaggacgtatctgg
attaacacttacaaccaaatccaggctggatcaccattcggtggttacaaaaaatcaggt
atcggccgtgaaacgtataaagaaactttacgtcactatcaacaagttaaaaacttatat
atcgattattctgatgcagcaaaaggtatctataaataa

DBGET integrated database retrieval system