KEGG   Macrococcus sp. IME1552: BHM04_08090Help
Entry
BHM04_08090       CDS       T05070                                 

Definition
(GenBank) restriction endonuclease
Organism
macr  Macrococcus sp. IME1552
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: ATD31150
UniProt: A0A290UVJ6
LinkDB All DBs
Position
complement(1573784..1574644)
Genome map
AA seq 286 aa AA seqDB search
MTEPRDFDEWLSKFKKSIADYKYYVDFEKVKRNVNAIKVELNILNSLIGEEDIEEKFIEL
VDKYPETLKCIPILLAIRINQIPVKKIDEEAEFDFVKPNHTPEEYAIFMKETGLFDLLKN
HLISNLLDYVTGVETGLDSNGRKNRGGHLMEDLVEEYLKLLDIEYYKEMKTTDVQKKFGI
DLSSITNAGKTIKRFDFVVHNKGKVFAIEANFYQSGGSKLNETARSFKNLAIYSKDIENF
NFMWITDGGGWYSARNNLAETFGIMEHLYSIEDLQDGILQKIFYNN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgacagagcctagagattttgatgaatggttaagtaaatttaaaaagagtatcgccgac
tataaatactatgttgattttgagaaagtaaaacgaaatgttaacgcgataaaagtggaa
ttaaacattttaaactcgcttattggtgaagaagatatagaagaaaaatttattgaatta
gttgataagtatcctgaaacattaaaatgtataccaatattacttgcgattaggattaat
caaattccagttaaaaagatcgatgaagaagctgaatttgattttgttaaaccaaaccat
actccagaagaatatgccatttttatgaaagaaacgggtttatttgatttattaaaaaat
catttgatatctaatcttctagactatgtaacaggtgtagaaactggtttggacagcaat
ggtcgaaaaaatcgcggtggacatctaatggaagatttagtagaggaatatttaaagtta
cttgatattgaatattataaagaaatgaaaacgactgatgtgcagaaaaaatttggaata
gatttatcatctattacgaatgcaggtaaaacgattaaaagattcgatttcgtggttcac
aataaaggtaaagtctttgcaattgaagctaatttttatcaaagcggtggatctaaacta
aatgaaacagcaagaagctttaagaatttagcaatttattcgaaagatattgagaacttt
aactttatgtggattaccgacggcggtggttggtattcagcacgtaacaacttagctgaa
acatttggtatcatggagcatttgtattcaattgaagatttgcaggatgggattctacaa
aagattttttataataactag

DBGET integrated database retrieval system