KEGG   Macrococcus sp. IME1552: BHM04_09415
Entry
BHM04_09415       CDS       T05070                                 

Definition
(GenBank) thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
macr  Macrococcus sp. IME1552
Brite
KEGG Orthology (KO) [BR:macr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHM04_09415
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BHM04_09415
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BHM04_09415
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 HI0933_like Pyr_redox DAO FAD_oxidored NAD_binding_8 GIDA FAD_binding_2 Thi4 FMO-like AlaDh_PNT_C K_oxygenase FAD_binding_3 NAD_binding_7 MCRA Amino_oxidase Orthopox_F6 Lycopene_cycl
Other DBs
NCBI-ProteinID: ATD31394
LinkDB
Position
1815918..1816955
AA seq 345 aa
MKQLLDITIIGGGPAGLYAAFYAGLRGLKVRIIDQNNTLGGKLNLFPEKIVWDAGGIPPQ
PAAEIMQNLIKQGTTFNPEIILNTVVTDIKKENDFHFIVETNDKSYHSKTVIVAVGSGII
KPIKLDIEGADRYEVNNLHYVVPSLKRFKDKRVLISGGGNAAVDWAHDIAPIAKSVHIIC
RKEDFKGHEETVRQLDELGVIKMTNQTIHSLIAEADEIKQVEIIQNTDDTIQILDVDDVI
INHGFHMDCELLNDSSVQFERVDDFYIKGNANTSTNTPGIYAIGDILKHDAKVNLIIGCF
HDAATSINQIKMYLDPDAPSYGIVSSHNPIFEEENEKIKKKLFES
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaacaattattagatataacaattatcggtggtgggcctgctggtctttatgctgct
ttttatgcaggattacgaggtttgaaagtacgcatcattgatcagaacaatactttaggc
ggaaaacttaatcttttcccagagaaaattgtttgggatgctggtgggattcctcctcaa
cctgcagcagagattatgcagaacttgattaaacaaggcactacatttaatccagagatc
attctgaacaccgtcgttacagatataaaaaaagaaaatgactttcactttatcgtagag
acaaacgataaatcctatcactctaaaactgttatcgtggcagtgggttcaggtatcatc
aagccgattaaactggatattgaaggtgctgatcgatatgaagttaataacctacattat
gtagtcccttcattaaaacgctttaaagataagcgtgtacttatttctggtggtggaaat
gccgcagttgactgggcacatgatatcgctcctattgcaaaaagtgtgcatattatatgc
cgtaaagaagattttaaaggtcacgaagagacagtgcgtcaactggatgaattaggagta
atcaagatgacaaaccaaacaattcattcactgattgcagaagcagacgaaattaaacaa
gttgaaattattcaaaatactgatgacaccattcaaattttagatgtcgacgatgtcatt
atcaatcatggtttccatatggactgtgagctattaaatgacagttcagttcaatttgaa
cgtgttgatgatttttatattaaaggcaatgcgaatacttctacgaacacgccaggtatt
tatgctatcggtgacatattgaaacacgatgcgaaagtcaacttgattatcggttgtttc
catgatgcagcgacttctattaatcagattaaaatgtatcttgacccagatgcaccatca
tatggcatcgtttcaagtcacaatccaatattcgaagaagaaaacgaaaagataaagaaa
aaattatttgaatcataa

DBGET integrated database retrieval system