KEGG   Macrococcus sp. IME1552: BHM04_09815Help
Entry
BHM04_09815       CDS       T05070                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
macr  Macrococcus sp. IME1552
Brite
KEGG Orthology (KO) [BR:macr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHM04_09815
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BHM04_09815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA HI0933_like FAD_binding_2 K_oxygenase Thi4 DAO FAD_binding_3 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ATD31468
LinkDB All DBs
Position
complement(1893077..1894600)
Genome map
AA seq 507 aa AA seqDB search
MLNDTLKQQLAQYLELMEGDVVITASAGDDKTSQDMMDLLTQIKEMSSRITLKEAPLKRT
PSFTLARPEEEARITFAGVPLGHEFTSLVLALLQVSGRAPKADQSVIDQIKKLEGPFNFK
TFISLTCTKCPDVVQALNMMAVLNPNITHTMIDGAAFREESKDIMAVPTMFLDGEEFGSG
KATIEEIIGKLGGGTDASEFDAKETFDVLVIGGGPASGSAAIYAARKGLRTGIVAERIGG
QVNDTAGIENFITVKETTGPEFSQNLKEHINSYDIDVMNAVRVEKLEKIDDLVHVTLENG
GKLTSKTLIIGTGAKWRNMNVPGEAEYQTKGVAYCPHCDGPLFEGKHVAVVGGGNSGVEA
AIDLAGIVKHVTLLEFGEELRADKVLQDRLASLNNAEIIKSAATKELTGDTTLKALTYVD
RNTNEEHTLDLEGVFVQIGLVPSTEFVGDLVARNNRGEIIVDKNGATNIPGIFAAGDCTD
QTYKQIIISMGSGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacgatacattaaagcaacaattagctcaatatttagagttaatggaaggcgac
gttgtaatcacggcgagtgctggagatgacaaaacaagccaagatatgatggacttactc
actcaaataaaagagatgtcttcacgtatcactttgaaagaagcacctttgaaacgcaca
ccaagtttcacattagcacgtcctgaagaagaagcacgtattacatttgctggtgtgcca
cttggacatgagttcacttctcttgtcttagctttattacaagtaagtggccgtgcacct
aaagcagatcaatctgtaattgatcaaattaaaaagttagaaggaccatttaactttaaa
acattcatcagcttaacttgtacgaaatgtccagatgttgtacaagctttaaatatgatg
gcggtattaaatccaaatattacacatacaatgattgatggtgcagcatttagagaagaa
tctaaagatattatggctgttcctacaatgttcttagacggtgaagaatttggtagtggt
aaagctactattgaagagattattggtaaacttggtggtggaacagatgcttccgaattt
gatgcgaaagaaacatttgatgtattagtaatcggtggaggacctgcaagtggtagtgca
gcaatatatgcagcacgtaaaggtttgcgtacaggtatcgttgcagaacgtatcggtggt
caagtaaatgatactgctggtattgagaactttattacagtaaaagaaacaacaggtcca
gaattttctcaaaacttaaaagaacatattaatagttatgacattgatgttatgaatgct
gttcgtgttgaaaagttagaaaaaattgatgatttagtacatgttactttagagaacggt
ggtaaattaacatctaaaacattaattattggaacaggtgcaaaatggcgtaacatgaat
gtaccaggagaagctgaatatcaaacaaaaggtgtagcatattgtccgcactgtgatggt
cctttatttgaaggtaaacacgttgcagttgtaggcggcggtaactctggtgttgaagca
gcaatagatttagcaggtattgttaaacatgtaacgttattagagtttggtgaggaatta
cgcgcagataaagtattacaagatcgtttagcgtcattaaataatgctgaaataattaaa
tcagctgcaacaaaagaattaactggggatacgacgttaaaagcattgacatatgttgat
cgcaatacaaatgaagaacatacacttgatcttgaaggtgtatttgttcaaattggttta
gtgccgagcactgaatttgttggagacttagttgctagaaataaccgtggtgaaatcatc
gttgataaaaatggtgctacaaatataccaggtatttttgctgcaggtgactgtacagat
caaacttataaacaaatcattatttctatgggatctggtgcaacagcagcattaagtgct
tttgattatttaatcagaaattaa

DBGET integrated database retrieval system