KEGG   Macrococcus sp. IME1552: BHM04_11420Help
Entry
BHM04_11420       CDS       T05070                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
macr  Macrococcus sp. IME1552
Brite
KEGG Orthology (KO) [BR:macr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:macr03012]
    BHM04_11420
   03029 Mitochondrial biogenesis [BR:macr03029]
    BHM04_11420
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:macr04147]
    BHM04_11420
Translation factors [BR:macr03012]
 Eukaryotic Type
  Elongation factors
   BHM04_11420
 Prokaryotic Type
   BHM04_11420
Mitochondrial biogenesis [BR:macr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BHM04_11420
Exosome [BR:macr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BHM04_11420
  Exosomal proteins of breast cancer cells
   BHM04_11420
  Exosomal proteins of colorectal cancer cells
   BHM04_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Septin RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ATD31750
UniProt: A0A290UXB8
LinkDB All DBs
Position
2208868..2210055
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLSKKLGGEARSYDQIDNAPEEKERG
ITINTSHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIAGSALKALE
GEEKYEEKIMELMDAVDEYIPTPERDSEKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
EEIEIIGLTEEPSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREDVQRGQVLAKPGTI
TPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEM
NVELISPIAIEDGTRFSIREGGRTVGSGVVSVIEK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgatcgctcgaaaacacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgcaattgcaactgtattatcaaaaaaatta
ggtggggaagctcgttcttacgaccaaatcgataacgcacctgaagaaaaagaacgtggt
atcacaatcaatacttcacacatcgagtatgaaactgaaaaacgtcactacgctcacgtt
gactgcccaggacatgctgactatgttaaaaacatgatcactggtgctgctcaaatggac
ggtggtatcttagtagtatctgctgctgacggtccaatgcctcaaactcgtgaacacatt
cttttatcacgtaacgtaggtgtacctgcattagtagtattcttaaacaaagttgacatg
gttgacgatgaagaattattagaattagttgaaatggaagttcgtgacttattatctgaa
tacgatttccctggcgacgatattccagtaatcgctggttctgctttaaaagcattagaa
ggcgaagaaaaatacgaagaaaaaatcatggaattaatggatgcagttgatgagtacatc
ccaactccagaacgtgattctgaaaaaccatttatgatgccagttgaggacgtattctca
atcactggtcgtggtacagtagctacaggacgtgttgaacgtggacaagttaaagttggt
gaagaaattgaaatcatcggtttaactgaagagccatctaaaacaactgtaactggtgtt
gaaatgttccgtaaattattagattacgctgaagctggtgacaacattggtgcattatta
cgtggggtttcacgtgaagatgttcaacgtggacaagtattagctaaaccaggaactatc
actccacatactaaatttaaagctgaagtttatgtattatctaaagaagagggtggacgt
catactccattcttcactaactaccgcccacagttctacttccgtacaactgacgtaact
ggtgtagttaacttaccagaaggtactgaaatggttatgcctggagacaacgttgaaatg
aacgttgaattaatctctccaatcgcgattgaagacggaactcgtttctcaattcgtgaa
ggtggacgtactgtaggatcaggtgttgtatctgtaatcgaaaaataa

DBGET integrated database retrieval system