KEGG   Marinobacter adhaerens: HP15_1038Help
Entry
HP15_1038         CDS       T01922                                 

Definition
(GenBank) sensory box histidine kinase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PAS_9 PAS_4 HisKA PAS PAS_3 HATPase_c_3 HATPase_c_2 DUF668 Rcd1
Motif
Other DBs
NCBI-ProteinID: ADP96802
UniProt: E4PG60
LinkDB All DBs
Position
complement(1057070..1058584)
Genome map
AA seq 504 aa AA seqDB search
MNDFSTPSVFSLHDADPQPGLILDATGSVLEGNLASHHLCQNANLTSLFHLLPVNVQALV
KSSLEQERSIENVEARIPADTTERFLVWTFVPDIGSSTVLARAKDATDEIINREEATRSN
RLYRLITENTTDLISRHAPDGRFIDATPASWRLLGYWPEELRGKPLEEIFRGDQVVQKLA
ETRNQLRDDGYATMTLEIIHRDGSRRWFEIASRAIRETYTGAVIEVISVSRDITARVESE
ENNRRLADELAHTARLATLGELASSIAHEMNQPLATIVNFASASQRYLKSARTNPECLDR
VDDGLQKIVHHANRASEVIKRLRAFLRKGQKRTAPIALNEVVSNVARLCQWEAEKNKVQI
RENLACCAPVITADPVLLEQVLINLIRNGIEATVEARGEDNPGPHSQIAITTCINDQNET
LIEVIDEGPGLDAQGIRQMFQPFYTSKPQGLGLGLSMSRSIIEGFGGFLDARPAATGGLS
LICRFPASPGHKNRTPNTEMQPDE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttttccactccaagtgtatttagtttgcatgacgccgacccgcaacccggt
ttgatcctggatgcgacaggcagcgttctggagggcaacctggccagccatcatctttgc
cagaacgccaacctgacctcgctgttccatctgctgccggtcaacgttcaggcgcttgtg
aagtcgtccctggagcaggaacgatcgatcgagaatgtggaagccagaattccggcagac
accaccgagcgtttcctggtgtggacgttcgtccccgatatcgggagctcgacggttctg
gcgcgggccaaagacgctacagacgaaatcatcaaccgggaagaagcgacccgctccaac
cgtctttaccggctgattaccgagaacaccaccgacctcatttcccgccatgccccggac
ggacggtttatcgatgccacgcccgcatcctggcggctgctgggctactggccggaagaa
ctgaggggtaagcccctggaagaaattttccggggcgatcaggtggttcagaagctggct
gaaacccgcaaccagctacgggacgacggctacgccaccatgactctggagattattcac
cgggacggttcccgccgctggttcgagattgccagcagggccattcgggaaacctacact
ggcgctgtgattgaggtcatcagcgtatcccgggatatcaccgcccgggtagagtccgag
gagaacaaccgcaggctggccgacgaactcgcccacaccgccaggctcgccactctgggg
gagcttgcctcaagcattgcccacgagatgaaccagccattggccaccatcgtgaacttt
gccagcgccagccagcgctatctcaaaagcgcccgaaccaatcccgaatgcctcgatcga
gtggacgacggcctccagaagattgttcaccacgccaaccgggcctcggaggtcatcaaa
cgtttgcgagccttcctgcgcaagggccagaagcggaccgcaccaatcgcactgaacgaa
gtcgtcagcaatgtcgcccgtctttgccaatgggaggccgagaaaaacaaggtgcagatc
cgagagaatctggcctgttgtgcgcccgtcatcaccgccgacccggtgctgctggaacag
gtgctgatcaatctgatccgcaacggtatcgaagccactgttgaggctcgcggtgaggat
aaccccggcccacactcgcagatcgccataacgacctgcattaacgatcagaacgaaacc
ctgattgaggtcatcgacgaaggcccggggctcgacgcgcagggcattcgccagatgttc
cagccgttctataccagcaagccccaggggcttggcctggggctctcgatgagccgttcg
attatcgaaggctttggaggcttcctggacgccaggccggcagcaacgggcggactctcc
ctgatctgccgcttcccggccagcccgggccacaagaacagaaccccgaacacggagatg
cagccagatgagtga

DBGET integrated database retrieval system