KEGG   Marinobacter adhaerens: HP15_1054Help
Entry
HP15_1054         CDS       T01922                                 

Definition
(GenBank) multi-sensor signal transduction histidine kinase
  KO
K14986  two-component system, LuxR family, sensor kinase FixL [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_1054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_1054
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_1054
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_1054
Protein kinases [BR:mad01001]
 Histidine kinases
  LuxR family [OT]
   HP15_1054
Two-component system [BR:mad02022]
 LuxR family
  FixL-FixJ (nitrogen fixation)
   HP15_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c PAS HisKA PAS_9 PAS_4 HATPase_c_5 PAS_8 PAS_7 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADP96818
UniProt: E4PG76
LinkDB All DBs
Position
1075525..1077102
Genome map
AA seq 525 aa AA seqDB search
MTEAVSENSEVTVLLVDDNPQNLKVLYETLKDKGYRLLIANEGEKALDLAHRHQPEVILL
DIMMPEMDGYEVCERLKAAPQTADCAVVFLSALDDLQAKVKGFSLGGADYISKPFQSQEV
IARVKTHASVIRLERELQARNRELQSDQARILNSISEGIYGLDENGIIEFANPAAASIVG
CPVEELIGRDFFETHFATAGDNPDGLPVKATCQQGVAENQRDIRMLRADGTGFPAEYRST
PKLDSDELHGAVVVFRDITAELNNEKALEDARQLVQEQRDQLAHTSRLTTMGEMAAGVAH
EVNQPLTAITNYARVAKRMMAKESPDMGLLQETLDKIEAQSHRASEIIRRIRRFMKKPAT
GKEVLSVPALLEDTRQFAEVDMRNNKGAIELSVPEDMPEVLADPVQVQQVALNLIRNALE
ATSSIDSSAPVEVSASAQGGTCVRIQVRDHGIGLSEDAEEKLFLPFFTTKDEGMGIGLST
CRSLIQAQGGDIGFERPEGGGACFYFTLPVAGAQGSPCAPDGKPA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagctgtcagcgagaactcggaggtgacggttctgctcgtggatgacaatccg
cagaacctcaaagtcctctatgagaccctgaaggataaaggttaccggctactgattgcc
aacgagggcgaaaaggccctcgaccttgcccaccgccatcagcccgaagtgattctcctc
gatatcatgatgccggagatggacggttatgaagtctgcgagcgcctcaaggccgccccg
cagacggccgactgtgccgtcgtctttctgtctgcgctggacgacctgcaggcaaaggtg
aagggcttttcactcggcggtgccgactacatctccaagccgttccagtcccaggaagtg
atcgctcgcgtgaaaacccacgccagcgttattcgtcttgaaagagagttgcaggcccgc
aaccgggagctgcaaagtgaccaggcccggattctgaactccatcagcgaaggcatctac
ggcctcgatgagaacggcattattgaatttgccaatccggcggcggcatcaattgttggc
tgcccggtggaagagttgataggtcgtgatttcttcgaaacccacttcgcgactgccggt
gacaatccggacggactgccggtgaaggcgacctgtcagcagggtgtggccgagaaccag
cgggatatccgaatgctgagggccgacggaaccggctttccggcggagtaccgctcaacc
ccgaaactggactctgacgagctccacggtgccgttgttgtattccgggatatcaccgcc
gaactgaacaatgaaaaggcgctggaggatgcccggcaactggttcaggaacagcgcgac
cagcttgcccatacctcgcgcctgaccaccatgggtgaaatggccgccggcgttgcccat
gaggtgaaccagccgctgaccgccatcaccaattatgcccgggtcgccaagcggatgatg
gcaaaggaaagccctgacatggggctgctccaggagaccctcgacaagatcgaggcacag
tcccatcgcgccagcgaaatcatccgacgcattcgtcgattcatgaaaaaaccggcgacg
ggcaaggaagtactgtcggtgcctgcgttgctggaagacacccggcagtttgccgaggtg
gatatgcgtaataacaagggcgctattgagctgtccgtgcctgaggacatgcctgaggtt
ctggccgatccggttcaggtacagcaggtcgccctgaatctgattcgcaacgctctggaa
gcgaccagcagtattgattccagcgcgccggtagaagtgagtgccagtgcgcagggtggc
acctgtgttcgaatccaggtgcgggatcacggcatcggcctctcggaagatgccgaagag
aaactgttcctgccgttcttcacgaccaaggatgaagggatgggtattggcctttcaacc
tgccgttccctcatccaggcgcagggtggcgacatcggtttcgagcggccggaaggcggt
ggtgcctgtttctatttcacgttgcccgttgccggcgcccagggttccccctgcgcaccg
gatggcaagcctgcctaa

DBGET integrated database retrieval system