KEGG   Marinobacter adhaerens: HP15_116Help
Entry
HP15_116          CDS       T01922                                 

Definition
(GenBank) two-component sensor
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad01503  Cationic antimicrobial peptide (CAMP) resistance
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_116
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    HP15_116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_116
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_116
   01504 Antimicrobial resistance genes [BR:mad01504]
    HP15_116
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_116
Protein kinases [BR:mad01001]
 Histidine kinases
  OmpR family
   HP15_116
Two-component system [BR:mad02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   HP15_116
Antimicrobial resistance genes [BR:mad01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    HP15_116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_2 HATPase_c_5 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADP95880
UniProt: E4PJ61
LinkDB All DBs
Position
complement(126110..127477)
Genome map
AA seq 455 aa AA seqDB search
MLSTEPFRSIDKSTLMTAQKSIRKTALQYGMVFSILYFLLIFFSHTYVIEELSNESRKHR
LDKEVESFQTIIANEMPTADEIGSMIDQFQLLLEHALIVEMKDGSVIASNNVNQTKLRMI
SEKPAGFVEISHGADRLLGLKRGVGIDSSLSSITILEMESGLAERSSGAHLTLLAASAIL
LVVLLALVGTTTYLALKPIEHIKEDMRRLQSGKQPRLNPDAPEEFSPLIKQFNNLLELAS
RRLDRHRRLNSDLSHMVKTSISANLAILSDTGSLPPSRDDIEFMTSNLKDLSRSLNYRMS
KADISGRQMGQTCLPIEIANNVISVMEKIFPDKSFRINTSLPNNFSWPMERQDLSELFGN
LLENGGKWSQAEIDVSISQTDSGLTIEVADDGPGITPEAASKVMDRGSRLDETVSGFGLG
LSIVSEILEDNFGRMNIGPSETGGARITVVLPFPE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
ttgctttcaactgaacccttccgctcaatcgacaaaagcaccctcatgacagcgcagaaa
agcatccgaaaaactgcactccaatatggcatggtttttagcatcctgtattttctgctt
atttttttctcacacacctatgtgatagaggagctttcgaacgagtccagaaaacatcgt
cttgacaaagaggtggagagttttcaaaccatcattgcaaacgaaatgccgacggccgac
gagatcggaagcatgatcgatcaattccaattgctactggaacacgccctcattgttgaa
atgaaagatggaagcgtcattgccagtaacaacgtaaatcaaacgaagttgcgtatgatc
tcagaaaagccggcgggctttgtcgaaatatcccacggtgcggatcgccttctcggatta
aaacgtggtgtcggaattgatagttcgctttcgtcaatcaccatcttggaaatggaaagc
ggactagctgagcgatccagtggggctcacctgaccttgctggctgcctccgcaatatta
cttgttgttctcttggctctggtaggcaccactacttacctggctttgaaaccgatcgaa
cacatcaaggaagacatgaggagactgcaatctggcaaacaacctcgtttgaatcctgat
gcaccagaggagttcagtccgctgatcaaacagttcaataacctacttgaactagcaagt
cgtcgccttgaccgccatcgccgcctcaattccgatctttctcacatggtcaagacctcg
atctctgccaatctcgcaatcttgtcagacactggttcattacctccgtcccgcgacgac
atagagttcatgacctccaacctaaaggatctaagccggtccttgaactaccgcatgagc
aaggcagatatctccggcaggcagatggggcaaacatgtttgccgattgaaatagcgaac
aacgtcatttctgtcatggaaaaaatctttcccgataagagtttccgtattaatacatcc
ttgccgaataacttcagttggcccatggagcgtcaggacctatcagagttattcggtaac
ctgctcgaaaacggcgggaagtggagtcaggctgagattgacgtttcaataagccagacc
gattccgggctaacgatagaagttgcagacgacggccctgggattactccagaagcggcc
tcaaaagtgatggatagaggttcccggcttgacgaaaccgtttctggatttggattggga
ctgtccatcgtgtccgaaatactagaagacaatttcggacggatgaacattggcccctca
gaaacggggggcgccagaattacagttgtgcttcctttcccagagtag

DBGET integrated database retrieval system