KEGG   Marinobacter adhaerens: HP15_1177Help
Entry
HP15_1177         CDS       T01922                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mad  Marinobacter adhaerens
Pathway
mad00061  Fatty acid biosynthesis
mad00780  Biotin metabolism
mad01100  Metabolic pathways
mad01212  Fatty acid metabolism
Module
mad_M00083  Fatty acid biosynthesis, elongation
mad_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HP15_1177
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HP15_1177
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mad01004]
    HP15_1177
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HP15_1177
Lipid biosynthesis proteins [BR:mad01004]
 Fatty acid synthase
  Component type
   HP15_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ADP96941
UniProt: E4PH05
LinkDB All DBs
Position
1210487..1210924
Genome map
AA seq 145 aa AA seqDB search
MMNIDEILEYLPHRYPFLLVDRVTEVEKGKSIKGYKNISFNESFFQGHFPNNPIMPGVLI
IEAMAQLSGILGFVTVGRKPSDGVVQYLAGSSKARFKRPVLPGDQLCMESELISGKRGIY
KFECRALVDGEVVCVAEILTAEREV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatcgacgaaattctggaatacctgccgcaccgatacccgtttttgctggtg
gatcgggtaacggaggtcgaaaaaggaaaatcgatcaagggctacaagaatatttcgttc
aacgagtcattctttcagggccacttcccgaacaacccgatcatgccgggtgtcctgatt
atcgaagccatggcccagctctcgggcattctcggttttgtgactgtgggccggaaacct
tctgacggcgtggtacaatacctcgccggctcgagcaaggctcggttcaagcgcccggtt
ttgccgggagatcaactgtgcatggagtcggaactcatctccggtaaacggggtatttac
aaattcgagtgtcgcgccctggtcgacggtgaagtcgtctgcgtggcagagattctgacc
gctgagagagaagtttga

DBGET integrated database retrieval system