KEGG   Marinobacter adhaerens: HP15_1613Help
Entry
HP15_1613         CDS       T01922                                 

Definition
(GenBank) sensory box histidine kinase/response regulator
  KO
K20974  two-component system, sensor histidine kinase [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_1613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_1613
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_1613
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_1613
Protein kinases [BR:mad01001]
 Histidine kinases
  Other
   HP15_1613
Two-component system [BR:mad02022]
 Other families
  SagS-HptB-HsbR (swarming activity and biofilm formation)
   HP15_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA HAMP DUF2222
Motif
Other DBs
NCBI-ProteinID: ADP97377
UniProt: E4PM49
LinkDB All DBs
Position
complement(1708810..1710753)
Genome map
AA seq 647 aa AA seqDB search
MNNSHRQQRPMSRKLLLLGALPAIVMFIVLMVFFTSVRLEDARRDLSDSSQMLADSLAPA
LEYAVVSGNTLALDQILSQSLRRSKADWIRVSDVMGDQLGFVSREPINPGEIPERYQIYE
AEILQQPLEFGSERTAEWFEPDYGFGSGSLRVGTVQVGVSQDVLAERRQDILWTSIAVGV
ALLLFSILIINHFLGAILAPIRDLAGRIGQLTDGDYQERPLNTHQSSKEIVAIEEQLNQL
AHHLAGLKTARDQTLAASEGAREKAEMANQAKSEFLATMSHELRTPLNGVLGMVDLIQEE
PLTQRQREYLNTARQSTEDLLTVIGDILDYSKMDSGTLKLESQEFNLRELISNCTATYRH
LAEQQGLALNLKFFGDWPDNPVVIGDPARLRQILAGLADNAIKFTGDGFINIQAGFFALE
DNCIILNCSVSDSGSGIPTERLHDIFNSFEQVDGGNSRLYGGTGLGLSLVQRLVELMGGH
IQVETDLGKGSSFRFELPFELADRPSEPEPSGTPPRETINGTSHALVVEDNPVNQRVATA
MLKRLGFHTDSANNGKEALDRVTTNHTGYDIILMDCQMPVMDGYEATRYIREWEQSNGQI
GTPIIALTADVLPGTEKSCLDCGMNDYLAKPVRKEMLREVLSRWIKL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagccacagacaacagcgccccatgtcgcgaaagctgctgctccttggagct
ctgccagccatcgtcatgtttatcgttctgatggtgttcttcacgtctgtgcgccttgag
gatgcgcgccgggatctgtccgacagcagccagatgcttgccgacagcctcgcccctgcc
ctggaatacgccgttgtctctggcaacactctggcactggaccagatcctttcccagtcg
ctgcgtcgcagtaaagccgactggatccgggtttctgacgttatgggagaccaacttggc
tttgtttcccgcgaaccgatcaacccaggtgagatacccgagcgctaccagatctatgaa
gccgagattctccagcagcccctggaatttggttcggagcgcactgcggagtggtttgag
ccggactatggctttggttccggttctctgcgggttggcactgttcaggttggcgtaagt
caggatgttcttgcggaacggcggcaggatattctctggacatcgatcgccgttggcgtg
gccctgctgctgttcagcattctgatcatcaatcatttccttggagcaattctggcaccg
atacgggacctcgccgggcgaatcggtcaactcaccgatggtgactaccaggagcgtccc
ctgaatactcaccagagttcgaaggagatcgttgccattgaagagcaactcaaccagctg
gctcatcacctggccggcctgaaaacagcacgggaccagaccctcgccgcgtccgaaggt
gcccgggaaaaggccgagatggcaaatcaggcgaaatctgaatttctggcaaccatgagc
catgagttgcgtacgcccctgaacggggtgcttgggatggtcgatctgatccaggaagaa
ccgcttacccaacgccagcgcgaatacctcaacaccgcccgccagtccaccgaggatctg
ttgaccgtcatcggggacatcctcgattactcgaagatggacagcggcaccctgaagctt
gaaagccaggagtttaaccttcgggaactgatttccaactgcaccgccacctaccgacac
ctcgccgagcaacagggccttgccctcaatctcaagttcttcggcgactggccggacaac
cccgtagtcatcggtgaccccgcgcgtttgcggcaaattctagcggggctggctgacaac
gccatcaagtttactggcgatggctttatcaatattcaggcgggctttttcgctctggaa
gacaactgcatcattctaaattgctcggtcagcgactccgggtccggcattccgaccgag
cgccttcacgacattttcaactccttcgaacaggtcgacggcggaaacagccggctatac
gggggcaccgggcttggcctctccctggtccagcggctggttgaactcatgggcgggcac
attcaggtggaaacggatctgggtaagggttcctcgttccggtttgagctgcccttcgag
ctggcggatcgacccagcgagcccgaaccgtccggtacaccgccaagggagacgattaat
ggcaccagccacgctctggtggtggaagataacccggtaaaccagcgcgttgccacagct
atgctcaagcgattgggtttccataccgattccgccaacaacggcaaggaagcactggac
agggtgaccactaaccacacaggctacgacatcatattgatggactgtcagatgcccgtg
atggacggatacgaggccacccgctatatccgggaatgggagcagagcaacgggcagata
gggacaccgatcattgcactaacggcagacgttctgcccgggacagaaaagagttgtctc
gattgtggcatgaacgactatctggccaagcctgttcgcaaggaaatgctgcgggaagtg
ctcagccgctggatcaagctctag

DBGET integrated database retrieval system