KEGG   Marinobacter adhaerens: HP15_2010Help
Entry
HP15_2010         CDS       T01922                                 

Definition
(GenBank) sensor histidine kinase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_5 HATPase_c_3 PilJ Mito_carr TraG_N
Motif
Other DBs
NCBI-ProteinID: ADP97774
UniProt: E4PQQ4
LinkDB All DBs
Position
2110128..2111972
Genome map
AA seq 614 aa AA seqDB search
MPVHSETFPGRLSQNQNEAPPRNIPRPRNSRYDLCMKSIIKHDASAPPRLRVLRRNGLAR
RYLFSALLIALIPLVVLAFMYDTQYVKALEKVTESRTNARLAGAENLLRTFLQERIYELE
ALADVPEVFDWLTTANAEEKPNAEVMAQLRQALDSPHLYGVVVKPSRYEAPLWYLTQTLL
QQVELDELPLTPFANGEIIGPALPTDSRPGWFVLRLSPTGLNPAPEAWVGLVVRLASLTD
QVKDLSLTGLQSPLIVTPQNVPITAVGNIPGQPSYSAKDINSNDFIEGWHIRLQWLGDPL
LGPLESARFGLILLASGAALAVILLSRHLSKRLEKQVTPLIEGADRVAGGDFDTPLHTEG
TAEIGYLAFALERMRLRLRRLVKSMVDVERRAILGQFSAGVAHEIRNPLATIKTTIQALS
RKESDPKRQKLMESVDHEIDRVNDVVQLLLDYARPREAKASKVNIIDVVETVKILADAVA
HRHGIELVQVEHESVYAWADSSQVRQIVMNLVMNAIQAMEGIGGRVTIRTKQQGLAVYVS
VSDNGPGVSADHLIHLTEPFFTTKTNGTGLGLAICRQLAQANQGNLRFQSVSGEGLKVTL
KLPLYLNNENQGSV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtccattcagagaccttcccaggccgcttatcgcagaatcaaaacgaagcaccg
ccgcggaatattccaagaccgcgcaactcccgatatgatctctgcatgaaaagcataata
aaacatgatgcctctgctccacctcgcttgagggtccttcgccggaatgggttagcgaga
cgatatctattcagcgcacttttaattgccctgatcccacttgttgtcctggcgttcatg
tacgacacacagtatgtgaaagcactggaaaaggtgacagaaagtcggacgaatgctcga
cttgcgggcgcagagaacctcttaagaactttcctccaggagcgaatctatgagcttgag
gctcttgccgacgtacctgaggttttcgattggttgaccactgcaaacgccgaagagaaa
cctaatgccgaggtcatggcacagctgcgccaggctctcgatagtccccatctgtatggg
gtagtggtcaagccatcccgatacgaggcgcccttgtggtatctaactcaaacgctgctg
cagcaagtggagttggacgaactgcctttaactccatttgccaacggagaaataatcggt
ccggccctaccaactgatagcaggcccggttggtttgttctcagactcagccctacaggg
cttaatcccgcccctgaagcctgggttggcttggttgtgcgccttgcgagccttaccgat
caggtaaaagatctgagcctcacgggcttgcagagccctcttatcgtaacgccccaaaac
gtacccattaccgccgtaggaaatatacccggacaaccttcctattccgccaaggacatt
aactcgaacgattttatcgagggctggcacatacgccttcaatggctcggtgaccctctg
ctgggccctttggagtcagccagattcgggttaatccttttggcttctggagcggccttg
gccgttattttgttgtcacgtcacctttcaaaaaggttggaaaaacaggtcactcctttg
attgaaggagctgacagagttgctggaggcgattttgatactccgctacacacggagggt
acagcggaaataggctatctggcctttgccctcgaacgtatgcgccttcgtcttcggcgg
ctggtaaagagcatggttgacgtagaacgccgtgccatactcgggcaattctccgcgggc
gttgcacacgagattagaaaccctctcgcaaccataaagactacaattcaggccctatcg
cggaaggagtcggatcccaaacgccaaaagttaatggaatcagttgaccatgagatcgac
cgagtaaacgatgttgtccaactgctcttggattacgctcgcccgagagaagccaaggca
agcaaggtcaacatcatcgacgttgttgaaacagtgaaaattctcgccgatgcagtggca
catcgccatgggattgagttggtacaagtcgagcacgaatctgtttacgcatgggccgac
tcttcacaggtccgacagatcgttatgaatctggtgatgaacgccattcaggcaatggag
ggtattgggggccgggttacaattcgaaccaaacagcaaggcttagcagtttatgtttct
gtcagcgataacggccccggcgtaagcgctgaccacctgatccacctaaccgagcctttc
ttcacaacgaaaaccaatggcaccggtctcggcctggccatttgcagacagctcgcgcaa
gctaatcaaggtaaccttcgtttccaaagcgtttctggcgaaggcctaaaagtaactttg
aaactaccgctctatttgaacaacgaaaaccagggatccgtttaa

DBGET integrated database retrieval system