KEGG   Marinobacter adhaerens: HP15_2093Help
Entry
HP15_2093         CDS       T01922                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K20973  two-component system, sensor histidine kinase SagS [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_2093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_2093
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_2093
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_2093
Protein kinases [BR:mad01001]
 Histidine kinases
  Other
   HP15_2093
Two-component system [BR:mad02022]
 Other families
  SagS-HptB-HsbR (swarming activity and biofilm formation)
   HP15_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA HATPase_c_3 CREPT OmpH HAMP HATPase_c_2 UPF0242 ADIP
Motif
Other DBs
NCBI-ProteinID: ADP97857
UniProt: E4PRE8
LinkDB All DBs
Position
2191286..2193613
Genome map
AA seq 775 aa AA seqDB search
MSNGFKQRLSYRLTRDTVLVAMALGLVLNVVQITLDYFSAKDSMEKEIHALIDISNSPAS
QIAYNIDVRLAEELLDGLLRHPATIDARITDNDDETMAASSKSSPVSPYRWVSDLLFGPD
RVFRQELRVPQLEDLPLGHLIVTIDTYHYGALFLQRAGYTLISGLLKSLILSAALLAIFY
FVLTRPMLNVISALSQVRATSPEKVRLPIPANHREDEIGTMVGIINQHLETIDSSLAQLR
HAESAMKNYSTQLEQEVADRTREISEKNDALQRGNRALVKAKEDAVRRARARANFLASMS
HEIRTPLNGVLGMLGLALEGELDSAQRNRIEIALNAGESLLGLLNDILDISKVEAGKLSL
ENIPFSVRHLIEECATLHAQQARRKRIHLVTEIDPDLPEDFLGDPTRVRQVLNNLLSNAI
KFTDEGSVKLKAAYSGGSLRIDVVDTGIGMSTEGLHRIFSPFSQADAETTRLYGGTGLGL
TLCRQLVERMHGQILVDSREGSGTHFTVTLPLPVHEASEDYDLPRVDSRLKDIGIAMAIP
PDNPHRSAIEAQLRKWGIPIRGASRHPDGILLALANAGDEETLAFADNWQGAGVVLVDSS
GTLPPALGQQQLLSLPLRRDELLRCLLLAAGLLDSEEQTANAVEDDEQTGTEASLKILLV
EDNQVNQMVAVSLLKKLGHRTDHAENGLKAIQALENNHYDLVLMDCQMPVMDGYEATQRI
RQNPEWKELPIIAVTANVMQGDREDCLASGMNDYITKPYKREELRTVIDRWRPAI
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacggcttcaaacaacggctttcctatagactgactcgagacacggtcctcgtt
gccatggccctcgggctggtgctgaatgtggtccagattaccctggactactttagcgcg
aaggattccatggagaaggaaatccatgcgctgatcgatatcagcaacagcccggcctcc
cagattgcctacaacatcgacgtccgtctggcggaagagttgctcgacggcctgcttcgc
catcccgcgaccattgatgcccggattaccgataatgacgacgagaccatggcagcatcc
agcaagagcagcccggtctcgccctatcgctgggtcagcgatctgctgttcgggccggat
cgcgtatttcgacaggagctccgggttccgcaacttgaggatctgccacttgggcatctg
atcgtcaccattgacacctatcactatggggcgctcttcctccaacgagccggatacacg
ctgatcagcgggctactgaaaagcctgatcctgtctgcagctctccttgccattttctat
tttgtgctgacccgtcccatgctcaatgtgatcagcgcactgagccaggtgcgggctacc
tctcctgaaaaggtcaggcttccgatcccggcaaaccatcgggaagacgagatcgggacc
atggttggtatcatcaaccaacacctggaaaccatcgattcgagccttgcacaactccgg
cacgccgagagtgccatgaaaaactactccacccagcttgagcaggaggtggcggaccgg
acccgggagatctccgaaaagaacgatgctttgcagcgtggtaatcgcgccctggtcaaa
gccaaggaagatgcagttcgccgggcgcgggcaagggccaatttcctggccagcatgagc
catgagatccggactccgctcaatggagttctcgggatgctcggcctggcactcgagggc
gagctggattctgcccagcgcaacaggatagaaattgccctgaacgccggtgaaagcctg
ctcgggctgcttaacgacatactggacatctcgaaagtggaggccggcaaactcagtctg
gaaaacatccccttcagtgtccggcacctgatcgaagagtgcgcgacactccatgcccaa
caggcgcggcgcaagcgtattcacctggtcaccgaaatcgatccggatctccctgaagac
ttcctgggagacccgacacgggtacgccaggtgctcaacaacctcctgagcaatgccatc
aaattcacggacgaaggcagcgtgaaactaaaggcagcctactccgggggtagcctgaga
atcgatgtcgtggataccgggatcggtatgtctactgagggcctgcaccggattttctca
cccttctcccaggctgatgcagagaccacgcggctttatgggggcaccggtctcggcctg
acgctctgccgtcaacttgtcgaacgtatgcatggccagattctggtggactcccgggag
ggcagcggcacacacttcaccgttaccctgcccctgccggttcatgaagccagcgaagat
tatgatctgccccgcgtggattcccgcctcaaggacattggcatagcgatggcaatacca
ccggacaacccacaccggtctgcgatcgaagcccaacttcgcaaatggggcatcccgata
cgcggcgcgagcagacacccggatggaattcttcttgcccttgccaacgccggagacgaa
gaaaccctggcattcgccgacaactggcaaggcgcaggcgtcgtactggtggactcttcc
ggcaccctgccccctgccctggggcagcaacagctgctctcgttgccattgcgtcgggat
gaattgctacgttgcctgcttctggccgcagggctgctggacagcgaggaacaaacggcc
aacgccgtggaagacgatgagcaaaccggcacggaggcttccctgaaaatccttctggtg
gaggacaatcaggtcaaccagatggtggccgtcagcctgctcaagaaactcggccatcgc
acagatcacgcagagaacggcctcaaggccatacaagcactggaaaacaaccactatgac
ctggtgctgatggattgccagatgccggttatggacggctacgaagctacacagaggatt
cggcaaaacccggaatggaaagaactgccgatcatcgctgttaccgcaaatgtgatgcag
ggcgaccgcgaggactgcctcgcctcaggcatgaacgactacattaccaagccgtacaag
cgcgaagagctcaggacggtcatcgaccgctggcgccccgcgatttga

DBGET integrated database retrieval system