KEGG   Marinobacter adhaerens: HP15_2298Help
Entry
HP15_2298         CDS       T01922                                 

Definition
(GenBank) chemotaxis histidine kinase
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
mad02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_2298
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    HP15_2298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_2298
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_2298
   02035 Bacterial motility proteins [BR:mad02035]
    HP15_2298
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_2298
Protein kinases [BR:mad01001]
 Histidine kinases
  CheA family [OT]
   HP15_2298
Two-component system [BR:mad02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   HP15_2298
Bacterial motility proteins [BR:mad02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HP15_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Hpt HATPase_c H-kinase_dim SHOCT HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADP98062
UniProt: E4PGF1
LinkDB All DBs
Position
complement(2419482..2421632)
Genome map
AA seq 716 aa AA seqDB search
MAFDADEEILQDFLVEAGEILEKLSEQLVDLERHPDDSDLLNAIFRGFHTVKGGAGFLQL
EALVNCCHSAENVFDILRNHKRKVDSELMDVVLEALDYVNAMFEQVRNHEELTPAPDELI
ARLDALAQPEGEGAPATAAQPEQEESEPAEDGGDITDDEFEQLLDALQDEKSAEVSSASS
AGSAGGDQESSGDDEITDDEFEALLDQLHGKGQFAGAPAGEEEASSKEEKPAAKAGSAGG
DDLITDDEFEKLLDDLHGKGGSPTAGGEPSASKEPAAPKQPSAPKQPASSKEPASPKANT
SKPEKSKPAERPEAKGAAAPAMPARENAPAAETTVRVDTKRLDDIMNMVGELVLVRNRLQ
RLGAESEDEHMHKAVSNLDVVTTDLQSAVMQTRMQPIKKVFGRFPRVVRDLARNLKKEVN
LVMHGEETDLDKNLVEALSDPLVHLVRNSVDHGIEAPEVREKAGKPRQGTVTLSAEQEGD
HILLFIEDDGAGMDPEVLRRKAVEKGIYDQDAADRLTNSECYNLIFAAGFSTKEQISDVS
GRGVGMDVVKTKIGQLNGQLSIESELGKGSRIVIKVPLTLAIMPTLMIMLGDQSFALPLV
NVVEIFHLDLTKTNIVDGRECIVVRDKVFPLFHIKRWLVRGGAGQEVPDNAHVVIVAMGT
KQVGFVVDQLVGQEEVVIKPLGRALQGTPGMAGATITGDGRIALIIDVPSLLQHYG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgatgctgatgaagagattttgcaggacttcctggtagaagccggcgagatc
ctcgaaaagctgtcagagcagttggtagatcttgagcgacatcctgacgacagtgatctg
ctcaacgccatcttccgtggtttccataccgtgaaaggcggagccggcttccttcagctt
gaagcgctggtgaactgctgccattccgcggaaaacgttttcgacatcttgcgtaatcac
aagcgcaaggtggattccgaactgatggacgtggttctagaagcactcgactacgtcaat
gccatgtttgagcaggtccgcaatcatgaggagctgacaccggctccggacgaacttatt
gcccgtctggatgccttggcccagcctgaaggcgagggggcaccggccactgccgctcaa
cctgagcaggaagagagcgaaccggcagaagacggtggcgacatcaccgacgacgagttc
gaacagcttctggatgcattgcaggacgagaaatcagcggaggtttcctcggcttcgagc
gccggatcggccggcggtgaccaggaaagttctggagacgacgaaataaccgacgacgaa
ttcgaagcgctactggaccaactgcacggaaaaggtcagtttgccggtgcgccagctggc
gaggaagaggcttctagtaaagaagaaaagccggctgccaaggccggatctgctggcggc
gacgacctgatcaccgacgacgaattcgagaaactgctggacgatcttcacggcaagggc
ggaagcccgaccgcgggcggagagccttcagcctcgaaagagcctgcagctccaaaacag
ccctcagcgccgaaacagcctgcatcttcaaaagagccggcttcaccgaaagcaaacacg
tcaaagcccgaaaaatcgaagccagccgagaggccggaggccaaaggcgctgccgcaccg
gcgatgcctgctcgcgagaatgccccggccgcggaaacgacggttcgtgtcgacaccaag
cggctcgatgacatcatgaatatggtgggtgagctggtgctggtgcgtaaccgcttgcag
cggctgggtgctgaaagtgaagacgaacacatgcacaaggcggtatccaacctggatgtg
gttacgactgatctccagtccgccgtcatgcagacccgcatgcagccgatcaaaaaggtg
ttcggcaggttcccccgcgttgtgcgcgatctcgccagaaacctcaagaaagaggtgaac
ctggtgatgcatggcgaggaaaccgatctcgacaagaacctggttgaagcgctgtctgat
ccgctggttcacctggtgcggaattcggtggaccacgggatcgaggctccggaagtccgc
gagaaggccgggaagccacgccagggaacggttaccctctctgccgagcaggagggagac
catattctgctgtttatcgaggatgacggcgcgggcatggatccggaggtcctgcgccgc
aaagcagtcgaaaagggtatctacgaccaggatgcagcggaccggctgaccaattcggag
tgttacaaccttatttttgccgccggattctccaccaaggagcagatttcggatgtgtcc
ggacgtggcgtcggcatggatgtggtgaaaaccaagattggccagctcaatggccagttg
agcatcgaatccgagctgggcaagggctctcgcattgtcatcaaggttccgctgacgctc
gccatcatgcccaccctgatgatcatgctgggcgatcaatcctttgcgttgccgctggtc
aacgtggtcgagattttccatctggacctgaccaagaccaacatcgtcgatgggcgcgag
tgcattgtggttcgggataaagtcttcccgctattccatatcaagcgctggctggttcgt
ggcggtgctggccaggaggtgcccgataacgcccatgttgtcattgtggccatgggtacc
aagcaggtcgggttcgtggtcgaccagctggttggtcaggaagaagtggttatcaagccc
cttgggcgagcgctccagggtacgccaggcatggccggtgccaccattaccggcgatggc
cggattgcactgattattgatgtgccaagcctgttgcagcattacggttga

DBGET integrated database retrieval system