KEGG   Marinobacter adhaerens: HP15_2329Help
Entry
HP15_2329         CDS       T01922                                 

Definition
(GenBank) two-component sensor
  KO
K10942  two-component system, sensor histidine kinase FlrB [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_2329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_2329
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_2329
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_2329
Protein kinases [BR:mad01001]
 Histidine kinases
  Other
   HP15_2329
Two-component system [BR:mad02022]
 Other families
  FlrB-FlrC (polar flagellar synthesis)
   HP15_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 HATPase_c_2 HATPase_c_3 PAS PAS_4 HATPase_c_5 MLTR_LBD Serine_rich DUF2089 BLOC1_2 Med21
Motif
Other DBs
NCBI-ProteinID: ADP98093
UniProt: E4PGI2
LinkDB All DBs
Position
complement(2448699..2449937)
Genome map
AA seq 412 aa AA seqDB search
MSQAQFVLQSGAGGTKTNAAADVNDKVTALFPEQDDEAVDTALELFNRMSRQITDSYRTL
ESRVNQLSGELNQESLQRQQELEEKEQLADRLSTLLNALPAGVVVLDSQGVVTQTNPAAI
ALLGEPLDGARWVDVIHRCFAPRRDDGHEVSLKDGRRVSIEIRTMENQPGQLILLTDLTE
TRHLQAQLAHAQRLSAMGKMVASLAHQIRTPLSAAILYGGHLSQEDLDEEMRQRCASRLM
SRLTHLEQQVRDMLIFARGETRLAEELSADKLVSALASAVEGLKPAPGATVNLENKISSD
CRLMCNRDALVGACTNLVNNSLEAGARHVAVRVTEETGELVIRVVDNGPGFEPSDAARLT
EAFYTTKSHGTGLGLAVVQAVIKAHQGRFSIESPEQGGAVATLRLPQLRNRH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcacaatttgttcttcagtccggcgcgggcggcacaaagaccaacgctgcg
gcggacgtcaatgacaaggttaccgccctgtttccggaacaggacgatgaggcggtggat
accgccctggaattgttcaaccggatgtcgcggcagatcactgactcctaccggaccctc
gaatcccgggtcaaccagctttccggcgagctgaaccaggaatcgctccagcgtcagcag
gagcttgaagaaaaagagcagctggcagatcgtctgtccaccttgctgaacgcactgcct
gccggcgttgtcgttctggatagccagggcgtggtaacgcagaccaacccggcagctatt
gcgcttctgggggagcccctcgacggtgcccgctgggttgatgtcatccatcgctgcttt
gcgccccggcgggacgatggccacgaagtatctctgaaggatggtcgcagggtcagcatc
gagatccggaccatggaaaaccagcccggccagttaatcctgctgacagacctaaccgaa
acccggcaccttcaggcgcagctggctcacgcccagcgtctgtctgccatgggcaagatg
gttgcgtctctcgctcaccagatccgtaccccgctgtccgcggccattctttacggtggc
catctgagccaggaggatctggacgaagaaatgcgtcagcgctgtgcttctcgcctgatg
tcgcgcctgacccacctggaacagcaggtgcgggatatgctcattttcgcccggggcgaa
acccggctggccgaggagttatctgccgacaaactggtctctgcactggcatcggcagtc
gaggggctgaagccggctccgggcgcgacagtgaatctcgagaacaaaatctccagcgac
tgccggctgatgtgtaatcgggatgccctagttggcgcctgtaccaatctggtgaataac
agcctggaggccggcgctcgccatgtggcggttcgggtaaccgaggaaaccggggaactg
gtcatccgggttgtggacaacggcccaggttttgagccctcggacgctgcccggctgacc
gaagctttttatacaaccaagtcccatggcacgggtctcggccttgcagtggtgcaggcc
gttatcaaggcgcatcagggacggttttccattgaatcgccggagcagggcggtgctgta
gccaccctgcgtttgccgcaattacgtaacagacactga

DBGET integrated database retrieval system