KEGG   Marinobacter adhaerens: HP15_2415Help
Entry
HP15_2415         CDS       T01922                                 

Definition
(GenBank) sensory box sensor histidine kinase/response regulator
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA CHASE5 HAMP PhoU
Motif
Other DBs
NCBI-ProteinID: ADP98179
UniProt: E4PH76
LinkDB All DBs
Position
2549872..2552223
Genome map
AA seq 783 aa AA seqDB search
MPSKRFFKRLGIRPLAARLLAYVLLFSLFLSLVATGVQLIGEFERRKNDLLNDQTRAAEL
VSGSMSNNIWLMNFSEVANSLDDMKAVPAVQYGRVVTSTGETFSTGTYPEGRVISQTFPL
VFDRSNNRSPENVGTLTVTSSIDQIYKDLRNRALLNLLFQSIVVMLGTLGLLVIVRLTLS
RHLESMADYAARLNLDALVDPLKLKRKPRKTPDELSELEQALNKMRLQILEDTRSLRQTT
IQSQGERDEAVRANHAKNQFLANVSHELRIPLQSVLGYANLLTDTPLDQEQREYVLTLLS
ASESLSAIINDLLDISSMEAGKLVLEDIPFDLRETLNDLVHMLGSRAREKGLALELRIDE
NLPWALKGDPVRIRQILLNLTSNAIKFTDSGHVLISIEVLGRRDDKARLRIAVEDTGVGI
NPEDVPLVYEPYVQLGQQFQRQLPGAGLGLTICRQLVGLMDGSMDLESRPGEGSTFWMEL
TLPVAPENAARVRPDTRMVKNRRILVVDSYELSRKITLEMLSRHEVHIEAVKSAGEALTS
LRTAFDGHQPFDAIILDGFVPDMDSDLLCRQIRSNPLWSDMRLLILSSNPQRGDAEHFRQ
AGADAFLSKSLRESCLTPILNQLFADAAKEERRFLTRFSLQATTDTARRRELPCGRMKVL
LVEDNPVNRTLTRRLLEKLGCDVMTANDGEAAASLWQWHPFDLVFMDCVMPRVDGFEATR
RLREWEKTHNRARIPVVALTASAMEEDEERCRRCGMDSFVAKPVNIEMLRAVLEQYCQAS
AAS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
ttgccttcaaagcggttcttcaaacgattgggaatacgaccactggcggcaaggttgctc
gcctacgtattgctgttcagcctttttctgtctctggtggcaacgggcgttcagctgatc
ggagaattcgagcggcgcaagaacgatctgctgaatgaccagacacgggccgcggagttg
gtttccgggagcatgagcaacaacatctggctgatgaatttcagcgaggtggccaacagc
ctggatgatatgaaagcagtgcccgctgtccagtacgggcgggtggtgaccagcaccggc
gaaaccttcagcaccggcacttaccctgagggccgggtcatatcgcagacctttccactg
gtttttgaccgctccaacaaccgcagtcctgagaacgttggcacgctcaccgtcacctcc
tccatagaccagatctacaaagacctgcgtaaccgcgcgctcctgaaccttctgtttcaa
tccattgttgtcatgctgggcaccctgggcctgctggtgatcgttcgtttaacgctgtcc
cggcatctggaatccatggccgattacgccgcgcggctgaatctcgacgcgctggtcgac
ccgctgaagctcaagcgcaaaccccgaaaaacgccagatgaactctctgagctggagcag
gccctgaacaagatgcgcctgcaaatccttgaggacacccgctccctgcgacagaccacg
atccagtcccagggtgaacgggacgaggcggtgcgggccaatcacgccaagaaccagttc
ctcgcaaatgtcagccacgaactgcgtattcctctgcaatcagtgctgggctacgccaac
ctgctcaccgatacgccgctggatcaggagcagcgggaatacgtgctgaccttgttgagc
gcctcggaaagcctctcggccatcatcaacgacctgctggatatctccagcatggaagcg
ggcaagctggtactcgaagacattccctttgacctcagagaaactctcaatgacctggtg
cacatgcttggctctcgcgcccgggagaaaggcctcgcactggaacttcggatcgacgaa
aacctgccctgggcgctgaagggcgacccggttcgcattcgccagatattgttgaacctg
acctccaacgccatcaagtttaccgattccggccatgtgctgatcagtatcgaggtgttg
ggccgccgggatgacaaggctcgccttcgcattgcggtggaagacaccggcgtgggcatc
aacccggaagatgttcccctggtttacgagccctacgtgcagcttggccaacagttccag
cgtcaactgcccggtgcaggccttggcctcaccatctgccgccaactggtgggcctgatg
gacgggtccatggatcttgaaagccgcccaggtgaaggatcgaccttctggatggaactg
actctgcccgtggccccggagaacgccgcccgggttcggccggatacccggatggtgaag
aatcgccggattctggtagtggattcctatgagctatcccgcaagatcactctggaaatg
ctgtcccggcacgaagtgcacatcgaagcggtaaaatccgccggcgaggcgctgacgtcc
ctgcgaacggcgttcgatggccatcagccgttcgacgcgatcattctggatggctttgtg
ccggatatggacagcgacctgctgtgccggcagatccgtagcaacccgctctggtcagat
atgcgcctgctgatcctgtcgtccaacccgcaacggggcgacgccgaacatttccgccag
gccggtgcagatgctttcctgagcaaatctctgcgagagtcctgcctgacgccgatcctc
aaccagttgtttgccgatgcagccaaagaagaacggcgcttcctgacccgattttcgctt
caggctaccaccgataccgcccgacgccgggagcttccctgcggccgcatgaaggtgttg
ctggtggaagacaatcctgtgaaccgcaccctgacccgtcgactgttggaaaaactcggt
tgcgacgtgatgaccgccaacgatggcgaggctgcggccagcctctggcagtggcacccg
ttcgatctggtgttcatggattgtgtgatgccccgtgtggacggctttgaagccacccgc
cgcctgcgggaatgggagaaaacccacaaccgcgcgcgcatcccggtggtcgcgctgacc
gccagtgccatggaagaagacgaggaacgctgccgccgatgcggtatggattcgtttgtt
gccaagcctgtcaatattgaaatgctgcgggcagtactggaacaatattgtcaggcgtct
gctgcctcctga

DBGET integrated database retrieval system