KEGG   Marinobacter adhaerens: HP15_242Help
Entry
HP15_242          CDS       T01922                                 

Definition
(GenBank) histidine kinase internal region
  KO
K08082  two-component system, LytTR family, sensor histidine kinase AlgZ [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_242
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_242
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_242
Protein kinases [BR:mad01001]
 Histidine kinases
  LytTR family [OT]
   HP15_242
Two-component system [BR:mad02022]
 LytTR family
  AlgZ-AlgR (alginate production)
   HP15_242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_kinase DUF4231
Motif
Other DBs
NCBI-ProteinID: ADP96006
UniProt: E4PK75
LinkDB All DBs
Position
complement(227281..228321)
Genome map
AA seq 346 aa AA seqDB search
MTESEFFVPDLCRVRAVFLLLVTSELLVLVLAIVQAERGWIDWNYFGLLSLFVQWTTLTS
AALICLLRSRLARMSVSGATTTIVAIVLLDVLAFSLFADSVLHPQDGVAVWQGVAKKMLL
ALLIVLMVLRYFYLQHQWQQQREAEMQAHLASLQARIQPHFLFNSMNTIASLIAINPERA
EEAVLDLSELFRASLRTGDQLIPLSRELALCQRYLAIEALRLGDRLKLEWQIEEGLEHQA
IPPLTLQPLVENAIYHGIQPRPDGGTVRIEAQAKGEFVYLLVQNPKPDQNNQQHDGNRMA
LANIQSRLRALFGEPAVLKHSHQHDVYTVTLRLPRRKAGEQSARKQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgacagagagcgagttcttcgttccggacctgtgccgggtacgggccgtgttcctgttg
ctggtcaccagtgaactgctggttctggtgctcgccatcgtgcaggcggagcggggctgg
atcgactggaattacttcgggctgttgtcgctgttcgtgcagtggaccaccctcaccagt
gccgccctgatctgccttttgcgctcccggcttgcacggatgtccgtctccggtgcgaca
accaccatcgtcgccattgtgctgctggatgtgctcgccttcagcctgtttgcagacagc
gtcctccacccccaggacggcgtggctgtctggcagggcgtggccaagaaaatgttgctg
gcactgctgatcgtcctcatggtgctgcgttatttttacctgcagcaccagtggcaacag
cagcgggaagcggagatgcaggcgcatctggcatcactccaggcccgcattcagccgcac
ttcctgttcaacagcatgaacaccattgccagcctgattgccatcaatccggagcgggcc
gaagaagccgttctggatctttcggaactgtttcgcgccagccttcgcaccggcgaccag
ctgatcccgctatccagggaactggcgttgtgccagcgttacctggccatcgaagcactg
cgcctgggcgaccgcctgaaactggaatggcagattgaagaaggcctggagcaccaggcc
attcccccgctcacactgcagcccctggtggaaaacgccatctaccatggtatccagccg
cgcccggacggtggcaccgtcaggattgaagcccaggccaaaggcgaatttgtctacctg
ctggtacagaatccaaagccggaccagaataaccagcaacatgacggcaaccgaatggcg
ctggccaacattcagtcacggctacgggcgcttttcggtgagccggcggtgctcaaacac
agccaccagcacgatgtgtacacggttaccctgcgactgccgcgacggaaggccggcgag
cagagcgcccgaaaacaataa

DBGET integrated database retrieval system