KEGG   Marinobacter adhaerens: HP15_253Help
Entry
HP15_253          CDS       T01922                                 

Definition
(GenBank) extracellular solute-binding protein, family 3
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 HATPase_c HisKA Phosphonate-bd V-ATPase_G_2 HATPase_c_3 NMT1
Motif
Other DBs
NCBI-ProteinID: ADP96017
UniProt: E4PKX5
LinkDB All DBs
Position
241441..244149
Genome map
AA seq 902 aa AA seqDB search
MLGKEELTWLEGQDRFRIGLRSDQVPLVFDTGNGVLAGTYIDYLARLSDKLGVAMEPIVL
ETGQDSGPVRSELATDAVLTTRMPGMPVVPGKRFTDPLMSLTYGVFVSAGDAAIRTLADL
EGSRIAVIAGDPNQYPMLDPVEEFTPVPVSNVSEAVGQILSGQADAFLAPVPVVSDYLQS
AMVNGIGLSVLLDNSPVDVVLRVDTDRDLLYQVLNKAIAAIGHNEHRTIRQSWLQADQPS
LERSGLELSGSDMEWLKQHPDLKVAFRADWPPFEYTQDGRPTGLVPDLLTRLETELNVRF
TRTVAGSRMDAEEKLRSGEVDILPGLSRTPRTEEAFLFTRAYLTVPIALAIRDDGRFIGD
LRELRTERVGVVNRHAAHDYLLINHPNLDLYPMDTVEEGLLALSNGDLDVMVTHIPAVSY
TVARLGLSNLRITSITPYQYDLRLAVRKDNPELHRVLNKALGSLEASETESIYNRWIHLD
IEQETDYTVVRRVVLIAILVVLIFLYWNRKLSREVDERIRSENALRRSEDELRAAKLEAE
RLAREAEAASLAKSEFLANMSHEIRTPMNAVIGYSDLLSNSVTDPQQRNYLDAIRAGSRS
LLMLINDILDLSRIEAGKMRLDYSAVSVRRLLDDVRHIFDLRAREQGITLEVSVDSRMPG
AMMLDETRLRQVLFNLVGNAIKFTHDGGVTVRATAKPLKKRSAEAEQNPEAPERQYYKLI
VTVSDSGIGIPPDQVERIFDAFEQQEGQNTRRYGGTGLGLAISRKLARMMGGELEVESEQ
GSGSVFTVTLPRVEATVEQAEDEGVPKESDRLLAQTLSMQERGWLREQLAADFGDEWEAV
RESGDPEQMKDFARRVLAWGQRFRSRSVTRYGEKLLADVEAFNLDAVNSALEAFPKLLGR
EE
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
gtgctaggcaaagaggagctgacctggctggaagggcaggaccggtttcgtatcggtctt
cgcagcgatcaggtgccgctggttttcgataccggcaatggcgtgcttgcgggcacctac
attgactaccttgcccggctctccgacaaactgggcgtcgccatggaacccatcgtcctg
gaaaccgggcaggatagcggcccggtcaggagtgagctggcaaccgacgcggttctgacc
accagaatgccggggatgccggtggtgcccggcaagcgtttcaccgatcccctgatgtct
cttacctatggcgtgttcgtcagcgccggcgatgcggccatccggacccttgccgatctt
gagggcagccggattgcggttattgccggtgaccccaaccaatatcccatgctggacccc
gtcgaggagtttacgccggtgccggtcagcaacgtcagcgaagccgtcggccagatcctt
tcggggcaggccgatgcgtttctggcgccggtgcccgtggtgtccgattacctccagtcg
gcgatggtgaatgggatcggtctgtcggtactgctcgataacagcccggtagatgtggtg
ttgcgggtggataccgatcgggacctgctttaccaggtgctgaacaaggccattgccgca
atcggccataacgagcaccgcaccatccgccagtcatggctgcaggccgatcagccgtcc
ctcgaacgaagtggcctggagttgtccgggtcggatatggagtggctcaaacagcatccg
gatctgaaagtcgcgtttcgcgcggactggccgccgtttgaatacacccaggacggccgg
cccaccggcctggttccggatttgctgacccggctggaaaccgagctgaacgtgcggttt
acgcgcactgtcgctggaagccgcatggatgctgaagagaagctgcgttcgggcgaggtg
gatattcttcccggcttatcccggacgccgcgcactgaagaggcatttctgtttacccgg
gcctatctgaccgtgcccatcgcccttgccatccgggacgacggtcgctttatcggcgat
ctccgggaactccgcacggaacgggtgggtgtggtgaaccggcatgcggcccacgattac
ctgttgatcaatcatccgaacctggatctttacccgatggatacggtggaggaggggctt
ctggcgctatccaacggcgacctggatgtcatggttacccatattccggcggtcagctac
acagtcgcccggctgggactgtcgaacctaaggattaccagcatcactccctaccagtac
gacctgcgactggccgtacgcaaggacaaccctgagctgcaccgggtgctgaacaaggcg
ctgggcagtctcgaagccagcgagacagaatccatctacaacaggtggattcatctggat
atcgagcaggagaccgattacaccgtggtgcggcgggtggtgctgatcgccatcctggtc
gtgctgatcttcctgtactggaaccgcaagttgtcgcgggaggtggatgagcgtatccgt
tcggagaatgccctgcgccggagcgaagacgagttgcgggccgccaagctcgaagccgag
aggttggcccgggaggcggaggccgccagcctggccaagagtgagttcctggccaatatg
tcccacgaaatacgaacgccgatgaacgcggtgatcggctatagcgatctgctcagcaac
agtgttaccgacccgcagcagcgcaattacctggacgccatccgggcgggaagtcgaagt
ctgctgatgctgatcaacgacattctggacctgtcccgaatcgaggcggggaaaatgcgg
ttggactattccgccgtatcggtccgtcgtctcctggatgatgttcgccacattttcgat
ctgcgggcccgggagcagggcataaccctggaagtgagtgtcgactcgcgaatgcccggc
gccatgatgctggatgaaacccgtcttcggcaggtcctgttcaacctggtcggcaacgcc
atcaagttcacccacgacggtggcgtcacagttcgggcaactgcaaagccgctcaagaag
cggtcggcagaagcggaacagaacccggaagcgccagagcgccagtattacaagttgatc
gtcacggtcagcgatagcggtatcggcatcccgccggatcaggtagagcgtattttcgat
gcctttgagcagcaggaggggcagaacacgcggcgctatggtggaaccggtctcgggttg
gccatcagccggaagctggcccgtatgatgggcggtgagctggaagttgagagtgagcaa
ggttccggttcggtctttacggtgaccttgccccgggttgaggcgacggtggaacaggcg
gaagacgagggcgttcccaaggaatccgaccggctgctggcccagactctcagtatgcag
gagcggggctggctcagggaacagctcgcggcggattttggtgacgagtgggaagctgtg
agagagagtggcgatccggagcagatgaaagactttgcacgccgggtgctggcctggggc
cagcgattccgctcacgctccgttacccgttacggggagaagctgcttgcggatgtcgag
gcattcaacctggacgcggtcaacagtgctcttgaggccttcccgaagctgctcggccgc
gaagagtaa

DBGET integrated database retrieval system