KEGG   Marinobacter adhaerens: HP15_2662Help
Entry
HP15_2662         CDS       T01922                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K02476  two-component system, CitB family, sensor kinase [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_2662
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_2662
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_2662
Protein kinases [BR:mad01001]
 Histidine kinases
  CitB family [OT]
   HP15_2662
Two-component system [BR:mad02022]
 CitB family
  Unclassified
   HP15_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c PAS SPOB_a HATPase_c_5 dCache_3 PAS_8 HATPase_c_2 PAS_4 HATPase_c_3 PAS_7 HemY_N TarH
Motif
Other DBs
NCBI-ProteinID: ADP98426
UniProt: E4PJR2
LinkDB All DBs
Position
2811938..2813557
Genome map
AA seq 539 aa AA seqDB search
MLRKTKLKTRMILTLGLLGALQTMLIGGFAGYYLSDSLYDEIGQRALMVAKTVAATPAVI
DGVRSQDVDGLNRLATRLTKTNEALFIVIGDHEAVRLAHPDPTRIGHSMGDDDGDFGRKA
LVEGNAYVALARGSLGESMRGKAPITDPGNGEIVGIVSVGYSLGQVEATIQRYNFVLYGA
VGLMLLVTILSAIVIAGRFKQAIFGLEPEEIARLFREREATLQSVREGIIAVNREGTITT
ANRAAYETLDLPPDSPLAGRPILEVLPESSLMSVLESGHPDFDREIWLRGRQMVVNRLPV
RQGDEIIGVVASFRLRNELDQVSRQLTRIQQYADTLRSQTHEYSNKLHTIAGLIQIGATE
EALSLIGSEVSDHQALIHLLLEAVPDPIIAGCLLGKYNRAREMGLRLDIDPDSQMADLPA
SLPRDQLVSVLGNLIDNALDATRLKTGAGGRVQLSMTDLGQELIFEVQDQGPGIPESERQ
RIFEKGVSSKEGEARGYGLHLVQQFLGYWGGSVTVDNIPEGGSRFTLYLPKKPERRFES
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgaaaaaccaaactcaaaacccgaatgatcctgacgctgggcctgctcggtgcg
ctgcagaccatgctcattggtggctttgccggctattacctcagcgattccctgtacgat
gagatcggccagcgggcacttatggtcgcaaagaccgtggccgccacccccgccgtcatt
gatggcgtgcgctcccaagatgtggatggtctgaaccgcctcgccacgcgactgacgaag
accaatgaggctttgttcattgtgattggcgatcacgaagccgtacgcctggctcatccg
gacccgacccgtattggccactcaatgggtgatgatgatggcgactttggccgcaaggcc
ctagtggaaggcaacgcctatgtggcccttgccagaggcagtcttggcgaatccatgcgc
ggcaaggcgccgataaccgacccggggaacggggagatcgtcggcatcgtctcggtcggc
tacagccttggccaggtagaggctacgattcagcgctataactttgtgctctatggcgca
gttgggctgatgctgttggtcaccatcctgtccgccattgtcatcgccggtcgattcaaa
caggcaattttcgggctggaaccggaggaaattgcccggctattccgggaacgggaggca
acactccaatcggtgcgggaaggaatcattgccgtcaatcgggagggcactatcaccaca
gcgaaccgggcggcctatgaaacactggatttgccacccgacagcccgcttgccggcaga
cccattctggaggttctacctgaaagcagcctgatgtcggtactggaatccggtcacccg
gattttgaccgggagatctggctgcgtggccgccagatggttgttaaccgattgcccgtt
cgacagggagacgagatcattggcgtggttgccagcttccgattgcgcaatgaactggat
caggttagccgccaactcacgcggattcagcaatatgcggacaccctgcgcagccagacc
catgaatattccaacaaactccacaccattgccgggctcatccagattggggctactgaa
gaggcattgagcctcatcggcagtgaggtaagtgatcaccaggcgctgattcacctgcta
ttggaagctgtgcctgatcccattatcgccggctgcctgctcggcaaatacaatcgcgcc
agggaaatgggattgcgactggacattgatcctgacagtcagatggcagacctgccggcc
tccctcccccgggaccaacttgtcagtgtgcttggaaatctgatcgacaatgccctggat
gccacacgcctcaaaacaggtgccggtgggagggtgcagctctccatgaccgatctcggc
caggagctgattttcgaagtacaggaccaggggcccggtatcccggagtctgaacggcag
cggattttcgaaaaaggggtaagcagtaaggagggagaggcccgtggctatggcctgcat
ctggtccagcagtttctggggtactggggtggctcggtaaccgtcgataacatcccggaa
ggcggcagtcgctttaccctatacttaccgaaaaagcccgaacggaggttcgaatcttga

DBGET integrated database retrieval system