KEGG   Marinobacter adhaerens: HP15_2960Help
Entry
HP15_2960         CDS       T01922                                 

Definition
(GenBank) two-component sensor
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 HATPase_c_2 FixQ HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADP98724
UniProt: E4PN91
LinkDB All DBs
Position
complement(3104467..3105933)
Genome map
AA seq 488 aa AA seqDB search
MFRSKAGKAEKKSWRWFPSSLLGRVLLLTLLAMASAQIISSAAWIATFRAQQVEGLVATT
RNLAQSAAATAQFFNSLPLEYRHIVLDQLRDMGGTRFFVSLNDKRIDMVPLPDTERKQLV
TEEVETVLHKRLGNRINLYVDFVDPAELRILNTELPLDALPQSWAHYALTLEPLNPPVLV
TQIEVADGEWLYLAAALPAPFVSLEDEGIPGQQILFLVVMIAILFPVLAWLIRQQTRPLR
KLAKAARDLPLEDNQPPLVEKGSAEILAVTRSFNTMRRRLQSYISDRNQLFRAISHDLKT
PITRLRLRVDLIEDDVMRERLEADLRELELLAKNALQSMKDTDIHENPESVDVEQMLRGM
AEAYQGEGSGQVIVQGHCSSYRGKPLALKRCLGNLVDNAVKYGARAMVSIEDTGGQLVIH
VEDEGPGVSDDQLSRIFEPYYRLDKNQHQGFGLGLGIARNIAQSHGGELEISNRPTGGLH
VQLTLPRH
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggagtaaggcgggtaaagcggaaaagaaatcctggcgctggtttccttcctca
ttgcttggccgggtattgctgctgacactgctggcgatggccagcgcccagattatttcc
agcgccgcctggatagccacgtttcgggcccagcaggttgagggattggtggccaccacc
cgtaacctggctcagtcggccgcggcaacggcgcagttttttaactcgcttccgttggaa
taccggcacattgtgctggatcagctacgtgacatgggcggcacccgctttttcgtctcg
ctcaatgataagcgtatcgatatggtgccgttaccagacaccgaacgaaaacagctggtt
accgaagaggttgaaacggtactgcacaagagactgggcaaccggatcaacttgtatgtc
gattttgtcgaccccgccgagttgaggatcctgaacactgaattgcccctggatgcgctg
ccgcaatcctgggcccactatgcgctgactctggagcctttgaatccgccagtgctggtc
acccagatcgaagtcgcagacggtgaatggttgtacctggctgcggcactgccggcaccc
ttcgtgtcactggaggatgaaggcatcccggggcagcagattctgtttctggtggtgatg
atcgccatcctttttcccgtgctcgcgtggcttatccggcaacagacgcgcccgctaagg
aagctcgccaaggcggcccgggatctgccgctcgaggacaatcagccacccctggtcgag
aagggcagtgcggaaatcctggccgtgacccgcagctttaacaccatgcgccgccggttg
cagagttacataagcgaccggaaccagctattccgtgccatttcacacgacctcaagaca
cccatcacgcggttacgtttgcgggtggatctgattgaggacgatgtgatgcgggaacgt
ttggaagcggacctccgggaactggaattgctggcgaaaaatgcgctccagtccatgaag
gataccgacattcacgaaaatcccgagtcggtggatgttgagcaaatgctaaggggaatg
gctgaagcctaccagggcgagggctccggacaggtgatcgtgcagggacattgcagttcc
tatcggggtaagccgctggcgctgaaacggtgcctcggaaatctcgtggacaacgccgtc
aaatacggggccagagcaatggtgagtattgaagatacgggggggcagttggtgatccat
gtggaggacgaaggccccggtgtatccgatgaccagttgtcccgcattttcgaaccctat
tacaggctggacaaaaatcagcatcagggttttggtctcgggctcggaatagcgcgaaac
attgcccagagtcacggcggtgagctggagatcagcaaccgccccaccggaggattgcac
gtccagctgaccttgccccgccactga

DBGET integrated database retrieval system