KEGG   Marinobacter adhaerens: HP15_3167Help
Entry
HP15_3167         CDS       T01922                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_3167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_3167
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_3167
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_3167
Protein kinases [BR:mad01001]
 Histidine kinases
  NarL family
   HP15_3167
Two-component system [BR:mad02022]
 NarL family
  UhpB-UhpA (hexose phosphates uptake)
   HP15_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAMP HisKA_3 HATPase_c HATPase_c_2 Arfaptin
Motif
Other DBs
NCBI-ProteinID: ADP98931
UniProt: E4PQ66
LinkDB All DBs
Position
complement(3320305..3321528)
Genome map
AA seq 407 aa AA seqDB search
MTVYRKISLLMLAVFLLIYLIGALLYTQQARHDVQRELDGVAGLAQSLGNPAGLPGSAVS
GMRHLTPAGGVGSGSEGEVPVWFSALIAGESSRPVVNGWQVDPADEVEEIWEGFLLISGA
YAIGMGLCFLALFVMVRRGVRTLASLSEAMGAVSAGQLTSRLPRQGEQELDALVCRFNSM
ADALESEQQTVGRLLNELLQLQDREREHIARVLHDDLGQYLTGIRAQARSLLYDPDLGDR
QKQQARDLAEHCETIQKHFRHLLQDLHPLVMEQLGLGSAIRHLAEQWQQLSGLECRLAMD
ERLPEFTGEQQTHLYRFLQEALNNVSRHANASCATLAVARKDNELSIEVRDDGVGNDQLP
GNAGLGVRSMCERARCLGAEVRFLSRMGEGTRIRLAVPLSPNTGGVL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtatatcggaagatttccctgttgatgctggcagttttcctcctgatctatctg
attggagcgcttctctacacccagcaggcccgacacgatgtccagcgtgagctcgacggt
gttgccggcctggcacagagcctgggaaaccccgccggtcttccgggctccgcagtcagc
ggcatgcgccacctgaccccggcgggtggtgtgggatccggttccgagggagaagtacca
gtctggttctcagccctgattgccggagaatcctcccgaccagtggtcaatggctggcag
gttgatcccgccgacgaggttgaggaaatctgggaagggttcctgctgatctcgggtgct
tatgcaatcggtatgggcttgtgttttttggcgctgttcgtgatggtccggcgaggtgtg
cgcacgcttgccagtctgtccgaggccatgggagcggtatccgcgggccagctgacttcc
aggctgccgcgtcagggcgagcaggaactggatgcgctggtgtgccggttcaattccatg
gccgatgcgctcgagtctgaacagcagactgttggccggctccttaacgaactgctgcag
ttgcaggatcgggagcgggaacacatcgctcgggtactgcacgacgatctgggacagtac
ctgaccggaattcgggctcaggcccgcagtctgctctacgatccggacctgggtgaccga
cagaaacagcaggccagggatctggcggaacactgcgagaccatccagaaacattttcgg
cacctgttgcaggatttgcatccgctggtgatggagcaactgggtcttggcagcgcaatc
cgtcacctggccgagcaatggcagcagctcagcgggcttgaatgtcgcctggccatggac
gagcgcctgcctgaatttaccggcgagcagcaaacccacctttaccgatttctgcaggaa
gccctgaacaatgtttcccgacatgccaacgcgtcctgcgccacgctggcggttgcccgc
aaagacaacgagctgagcattgaggtgcgtgatgacggagtcggcaatgatcagctaccc
ggcaatgcgggtctcggcgtgcgctccatgtgtgagcgcgcccgctgtttgggtgctgag
gtcaggtttctgagcaggatgggcgagggaactcgcattcggcttgccgtgccgctcagc
ccgaataccggaggtgttttatga

DBGET integrated database retrieval system