KEGG   Marinobacter adhaerens: HP15_3222Help
Entry
HP15_3222         CDS       T01922                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
mad  Marinobacter adhaerens
Pathway
mad00061  Fatty acid biosynthesis
mad00620  Pyruvate metabolism
mad00640  Propanoate metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01200  Carbon metabolism
mad01212  Fatty acid metabolism
Module
mad_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP15_3222
   00640 Propanoate metabolism
    HP15_3222
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HP15_3222
Enzymes [BR:mad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HP15_3222
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HP15_3222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADP98986
UniProt: E4PQC1
LinkDB All DBs
Position
3374025..3375371
Genome map
AA seq 448 aa AA seqDB search
MAMLEKVLIANRGEIALRILRACKELGIKTVAVHSQVDRDLMHVRLADESVCIGPNSATD
SYLNIPTIISAAEVTDSVGIHPGYGFLAENADFAEQVEKSGFRFIGPKAETIRLMGNKVS
AINAMIKAGVPTVPGSDGPLDDDEERTLRIAKEIGYPVMIKAASGGGGRGMQVVHSEAAL
LKGVQITQSEAKNAFGDPTVYLEKFLEAPRHVEVQVLADMHGNCIHLGDRDCSMQRRNQK
VIEEAPAPNINPESRERTLKACTDACKEIGYVGAGTFEFLYQDGEFYFIEMNTRVQVEHP
VSEMVTGVDIVREQLRIASGLPLQYTQDDIRISGHAMECRINAEDPKTFIPSPGKVKHFH
APGGNGVRVDSHLYSGYTVPPYYDSLVAKLITWGDDRDIARRRMKNALDELVVEGIKTNQ
PLHRKLVRDGGFKQVDFTIHYLEKLMRD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggccatgttagaaaaagttctgatcgcaaaccggggtgaaattgccctccggattctg
cgcgcctgcaaggagctgggcatcaagaccgtggcagtgcattcccaggtcgatcgcgac
ctgatgcacgtacgtcttgccgacgagtctgtctgtattggccctaacagcgcgaccgac
agctacctgaacatccctaccatcatcagcgccgccgaggtaaccgattccgtgggtatt
caccccggctacggcttccttgccgagaacgccgattttgccgaacaggtggaaaagagc
ggatttcgctttatcggtcccaaggccgaaaccatccggctgatgggcaacaaggtgtcc
gccatcaacgcgatgatcaaggccggcgttccgaccgtgccgggctccgatggcccgctg
gacgacgatgaggagcggaccctgaggattgccaaggaaatcggctaccccgtcatgatc
aaggcggcttccggcggcggcggccgcgggatgcaggtggtccattctgaagcggccctg
ctcaagggtgtccagatcacccagagcgaggccaagaatgccttcggcgacccgacggtt
tacctcgagaagttcctggaagccccgcgccacgtggaagtgcaggtacttgccgacatg
cacggcaactgcattcacctgggcgatcgcgactgctccatgcagcgccggaaccagaag
gtgatagaggaagcaccggctccgaacatcaatccggaatcccgggaacgcaccctgaaa
gcctgtaccgatgcctgtaaggaaatcggttatgtgggcgccggtacgttcgagttcctg
tatcaggacggcgagttctatttcatcgaaatgaacacccgtgtccaggtagagcatccg
gtctccgagatggtcaccggtgttgatatcgtccgcgaacagctccggattgccagcggc
ctgccgctgcaatacacccaggacgacatccggatttccggccacgccatggagtgccgg
atcaacgccgaggatccgaaaacctttatccccagccccggcaaggttaaacacttccat
gccccgggcggtaatggtgtgcgggtggattctcacctgtacagcggttacacggttccc
ccctactacgattccctggtggccaaactgatcacctggggcgacgacagggacattgcc
cggcgccggatgaagaacgcgctggacgaactggtggtcgagggcatcaagaccaatcaa
ccgctgcatcggaaactggtacgcgatggtggctttaaacaggtagacttcaccatccac
taccttgagaaactgatgcgggattaa

DBGET integrated database retrieval system