KEGG   Marinobacter adhaerens: HP15_3408
Entry
HP15_3408         CDS       T01922                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
mad  Marinobacter adhaerens
Pathway
mad00230  Purine metabolism
mad00240  Pyrimidine metabolism
mad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HP15_3408
   00240 Pyrimidine metabolism
    HP15_3408
Enzymes [BR:mad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     HP15_3408
    3.2.2.-  
     HP15_3408
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: ADP99172
UniProt: E4PFA1
LinkDB
Position
3580595..3581977
AA seq 460 aa
MQETTINALVSPEGSLEILSNHEVNRLKDRSEGGLYRLFRQCALAVLNTGIETDDCKALM
ESHADFDVRLVPQPRGLKLELINAPGHAFVDGEMLRAIREHLFSVLRDIIYSHSIPQTAA
GFRRDDPEDLTNYVFHILRNARVLQAGRQPDLVVCWGGHSIGHEEYQYSKDVGHQLGLRA
LSICTGCGPGAMKGPMKGATIGHAKQRVKNGRYIGITEPGIIGAEAPNPIVNELVIMPDI
EKRLEAFVRCGHGVIVFPGGVGTAEEILYLLGILLHPDNADLPFPVVFTGRQENAEYFEM
IDKFIRNALGDEAASKYEIIIDDPVRVAQTMKKGMKEVETFRRAMQDAYYFNWMLKIDPV
FQLPFEPNHDNMRALELHRDQPVHLIAANLRKAFSGIVAGNVKEGGIRQVQEKGPFEIAG
DPTLIKPLEAMLEQFVTQNRMKLPGSSAYRPSYRIVSGAA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcaggaaaccaccatcaatgccctcgtctcaccagagggcagccttgaaattctctcc
aatcatgaggtcaaccgcctcaaggaccgcagcgaaggcgggctttaccggctgtttcgc
caatgcgcgctggcggttctcaatacgggcatcgagactgacgactgcaaggcattgatg
gaatctcatgccgactttgatgtccgcctggtaccgcagccccggggcctcaaactggaa
ctgatcaatgcgcccggccatgcctttgttgatggcgaaatgctgagggcgatccgcgag
cacctgttctcggttttacgagacattatctactcgcattcaatccctcagacagccgcc
ggttttcgccgggatgatccggaggacctgaccaattacgtattccacattctccgcaac
gcccgggtgctgcaggcgggaagacaaccagacctcgtggtctgctggggtggccactcc
atcgggcatgaagaataccagtacagcaaggatgtcggtcatcagttggggctcagggcc
ctgagcatctgcaccggatgtggcccgggtgccatgaaaggtcccatgaaaggtgccacc
attggccacgccaagcagcgggtaaagaacggtcgctacatcggtattacagaacccggc
atcattggcgccgaagccccaaacccgatcgtcaatgaactggtcatcatgccggacatt
gaaaagcgcctggaagcgttcgtccgctgtggtcacggcgtgattgtattcccaggcggt
gtcggcaccgccgaggaaattctctacctgctcgggatcctgctgcatccggacaatgca
gatctgcccttcccggtggtatttaccggccggcaggaaaacgcggaatacttcgagatg
atcgataagtttatccggaacgccctcggggatgaggctgcgagcaaatacgagatcatc
atcgacgatccggtgcgcgtggcccagaccatgaaaaaaggaatgaaggaggtcgagacg
ttccggcgcgccatgcaggatgcctattatttcaactggatgctgaagatcgacccggtg
ttccagctgccgttcgagcccaatcacgacaacatgcgggcgctggagctgcatcgggac
cagcctgtgcacctgatcgctgcgaatttgcgcaaggccttcagtggcattgttgccggt
aacgtcaaggagggtggtatacgacaggttcaggagaaggggccgttcgaaatcgcaggc
gacccgactctgataaaaccgctcgaagccatgctcgagcagtttgtgacccagaaccgg
atgaaactaccgggttcttcggcctacagaccgagctatcgcatcgtcagcggagcggcc
tga

DBGET integrated database retrieval system