KEGG   Marinobacter adhaerens: HP15_3431Help
Entry
HP15_3431         CDS       T01922                                 

Definition
(GenBank) multi-sensor signal transduction histidine kinase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA GAF GAF_2 PAS_3 GAF_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ADP99195
UniProt: E4PFC4
LinkDB All DBs
Position
3607942..3609765
Genome map
AA seq 607 aa AA seqDB search
MLREETLVIENALNDERFFDNPLVTGDPHIRFYAGAPLHDPQGQRVGTLCIIDRKPRSFS
EEDKTILRDLADLVEREFSIGAIRDHSEDRTRALNVLTEIVLDSAGDTNERAARALRIAC
DYLGLETGIVSRVTDTVYTIHWHFTRGTNPIENGTTLPLEQTYCALLLESSHKLFAIQNM
AESGFTNRPCYEVFGLETYLAAPIWIDGEIFGTVNFSSHSPRHRPFSATEEMFVTLFADW
VADTLYRVQRTETLNKLVTQAPGMLYQYRLWPDGHSSFPYTSPGIKEIYGIDVEEAAIDA
NKAIARVHPDDLPELLKSIEESAQTLSQWQLRYRVRLDTGGWSWVEGLAQPEALPDESIL
WHGYITNVDERQRIDEMKNQFISTVSHELRTPLTSISGSLGLILGGATGPVNEKTAQMLT
IAQRNSKQLRHLIDDLLDIEKLVSGNVTFDASVQRLDEAAEAAIEEIQPMARKRGVEVQL
NVLERDLYANYDIVRLTQAITNLLSNAIKFSPAGAAVRVDLSKSGDEAKLEVRDQGPGVP
ESFRDRIFQKFAQANSTSSRTKEGTGLGLAITRELMQAMGGEVDFESEEGSGACFWITLP
LAEPGTQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcgaggaaacacttgtcattgagaacgcactcaacgacgaacgcttctttgat
aatcctttggtaactggcgatccccatatccggttttatgcgggcgctccgctccacgac
cctcagggacagagggttggaacgctctgcatcatcgatcgcaagccccgatccttttca
gaagaagacaaaacaatcttgagggatctggcagatctggtggaacgggaattctcgatc
ggtgccatccgggaccactccgaggatcgcacccgagcgctgaacgtgctgaccgagatc
gtcctggattctgccggtgacaccaatgagcgagcggcgagagccctgaggatcgcctgc
gactatcttggtcttgaaaccggcattgtcagccgggtcaccgacacggtgtataccatc
cactggcatttcacccgtggcactaacccaatcgaaaacggcacgaccttacccctcgaa
caaacctattgcgccctgctcctcgaatccagccataaattgtttgccattcaaaacatg
gccgaatccggattcaccaaccgcccgtgttacgaggtcttcgggctggagacgtatctg
gcagcgcctatctggatcgacggcgagatctttggaaccgtaaatttttcgtcgcactcg
cccagacatcgcccgttcagtgccacagaagaaatgttcgtcactctctttgcagactgg
gtggccgataccctttatcgcgtccagcgcacagaaaccctgaacaaactggtaacccag
gcgcccggtatgctttaccaataccgcctgtggcctgacggacacagcagttttccttac
accagcccaggcattaaagagatctatgggattgacgttgaagaagcggctatcgacgcc
aacaaagccatagcccgggtacaccctgatgaccttcccgagctgctcaagtcgatcgag
gaatctgcacagactctttctcaatggcagctccggtaccgagtgcgtctggataccggc
ggctggagctgggttgagggactggcacaaccggaggctctgcccgatgaaagcatcctg
tggcacggttacatcaccaatgttgatgaacgccagagaatcgatgagatgaagaaccag
ttcatctccaccgtcagccatgaattacgaacacctttaacctcaatatccggttctctg
gggctgatccttggcggcgcaaccggtccagtcaacgagaaaaccgctcagatgctcact
attgcccaacgcaacagtaaacaactgcggcatcttatcgacgatcttcttgatatagag
aagctggtcagcggcaacgtgacgttcgacgcgtctgtccagagactggatgaagcagcc
gaggcagccatcgaagagatccagccgatggccagaaagcggggcgtcgaggtgcaactg
aatgtcctggaacgagacctgtatgccaactatgacattgttcggcttacccaggccata
acaaatcttctgtcaaacgcaatcaagttttccccggccggtgctgccgttagggtggat
ttgtccaaatctggggatgaggcaaagcttgaagtcagggatcagggccctggtgtgcct
gagagtttccgggacaggatttttcagaagtttgcccaggcgaactcaacctcttcaagg
acaaaggaaggaaccgggttgggcctcgcgattacgcgggaattgatgcaggcaatgggc
ggtgaggtcgatttcgaatccgaagagggatctggcgcctgcttctggatcaccttgccg
ctcgcggagccggggactcaataa

DBGET integrated database retrieval system