KEGG   Marinobacter adhaerens: HP15_3619Help
Entry
HP15_3619         CDS       T01922                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HP15_3619
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HP15_3619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO K_oxygenase FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 FMO-like Cohesin
Motif
Other DBs
NCBI-ProteinID: ADP99383
UniProt: E4PGS4
LinkDB All DBs
Position
complement(3815372..3816958)
Genome map
AA seq 528 aa AA seqDB search
MLDANIKEQLKAYMDKLQQPIELVAAYDDSKKSQELRELLEELEPMSSKISLRTEESNDV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDVIEQIQSLEGRFE
FETYFSLSCQNCPDVVQALNLMSVLNPNITNTSIDGALFQDEVEQREVMAVPSVYMNGEP
WGQGRMTLEEIVAKLDTSSSEKDAEKINQKDAFEVLIIGGGPAGASAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQNVKEYDVDIMNMQRAEKLIPASRPG
MLHQVRLENGATLKARSLVLSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGAEMRADEVLQKKLRSLKNVEIITSGQTTEITGE
NGKVNGLNYTDRTSGEQHHISLEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSVDESEDEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatatcaaggaacagctcaaggcctacatggacaagctgcagcagccg
attgagctggttgcggcctatgacgacagcaagaagtcccaagaactccgggagctgctg
gaagagctggagccgatgtcttccaagatcagtctccgcactgaagaatccaatgacgtg
cgtcgtccgtccttcgccatcaaccgagtaggcaccgatattggcgttcgctttgcgggc
atccccatgggccacgagtttacttccctggtgctggccctgctgcaggtgggtggccat
ccctccaaggcgtcccaggatgtgatcgagcagatccagtctctggaaggccggttcgag
tttgaaacctacttttccctgtcctgccagaactgcccggacgtggttcaggccctgaac
ctgatgagcgtgttgaacccgaacatcacgaacacttctatcgatggcgccctgttccag
gatgaagtggagcagcgcgaagtcatggcggttcccagcgtttacatgaacggtgagccg
tggggccagggccgtatgaccctggaagaaattgttgccaagctggacaccagctccagc
gagaaagacgccgagaaaatcaatcagaaagacgcctttgaggtcctgatcattggtggc
ggtccggctggcgcctctgctgccatctacgctgcgcggaagggcatttccaccggcatc
gcggccgagcgtttcggtggccaggtagctgacaccatgggcattgagaacctgatttcc
gtaccctacaccgagggtccgaaactggtggcggccatggagcaaaacgtcaaggaatac
gacgtggatatcatgaacatgcagcgcgctgagaagctgatcccggcgtcacgccctggc
atgctccaccaggtaaggctcgaaaacggtgccactctcaaagcgcgcagcctggtgctg
tccaccggtgcccgctggcgccagatgggcgttccgggagaggaagagtatcgcaacaag
ggtgtggcctactgcccgcactgcgacggccccctgttcaagggcaagcgcgtggcggta
atcggtggaggtaactccggtgttgaagcagccatcgatctggccggtatcgtgggccat
gtaaccctgatcgaattcggtgccgagatgcgcgctgatgaggtgttgcagaagaaactg
cggagtctgaagaacgtggagatcatcacgtccggacagaccaccgagattaccggggaa
aatggcaaggtcaacggtctgaattacaccgaccgcacctctggtgagcagcaccacatc
tccctggaaggtgtgtttgtacagatcggcctggtgcccaacaccgagtggctgaagggt
gacatcgaactgagccagcacggcgagatcatcgtcaacgaccgcaacgaaacctccatt
ccgggcgtttttgcagcgggcgacgcgacgactgtgccttacaagcagatcgtgatctcc
atgggcgaaggttccaaagccgccctcagcgcctttgacttcctgatccgcaattctgtg
gacgagagcgaagacgaagcggcgtaa

DBGET integrated database retrieval system