KEGG   Marinobacter adhaerens: HP15_3659Help
Entry
HP15_3659         CDS       T01922                                 

Definition
(GenBank) integral membrane sensor hybrid histidine kinase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA HATPase_c_3 HATPase_c_2 FleQ
Motif
Other DBs
NCBI-ProteinID: ADP99423
UniProt: E4PHC2
LinkDB All DBs
Position
3854356..3857739
Genome map
AA seq 1127 aa AA seqDB search
MAARQNIFRVRRSYNQWVANQTLEDYALRFTAKSARRWSAARVSNTALGAISFLALEAIG
GSITLHYGFDNAVAAILAVSLVIFLTAIPISYYAARYGVDIDLLTRGAGFGYIGSTITSL
IYASFTFIFFAIEAAIMAMALEMLFGVPLVLGYLICAVVIIPLVIHGITTISRFQVWTQP
AFIFLQLVPFVFIVYADASSVSDWTQFEGLNPVDSGGFSIVMFGAAAAVVFSLIAQIGEQ
VDFLRFIPEPRNAREKRRWWAAAMAGGPGWIVIGMLKILAGSFLAVLALKQGVTASEAAD
PTQMYLIAFNYITHSPEISLAMAGIFVILCQLKINVTNAYAGSIAWSNFFSRLTHSHPGR
VVWLFFNVAIALLVMELGVYRALEETLGFYGIVAIAWVGSLVADLVINKPLGLSPAHIEF
KRAHLYDINPVGVGAMLTASVVGIICHTGILGVYPEALSHFIAMGVALIMAPLIAWKTGG
RFYTARPFVPIATDHQLVQCTICEHHFEPEDLTHCPAYDGTICSLCCSLDARCADACKPG
AGYQEQLNQFLGSLMPKPVLAGLRSRLGHFLSLLVLINGLSGLLLSLIYFKTPVASPAEG
LLLSVTLWKVFFILVIVTGVICWLFVLAHESRVVAEEESRRQNRLLMEEIVAHERTDQAL
QQAKEQAEAANGAKSRYLTGISHELRSPLNAILGYAQLMENDETIPSHRKEALGVIRRSG
EYLADLIEGLLDISKIEAGRLDLHRDQVRIGLLMEQLVTMFRLQAEDKGLAFDYHCPNPL
PEMVTTDEKRLRQILINLLSNAIKYTDRGGVSLTLRYRSQVAEFTVRDTGEGIAPENVER
IFRPFERIRTPGQSRAGTGLGLTITRLLTEIMGGDISLESVPGQGSVFRVSLMLSSLHSS
TPRSISMPAKRIYGYHGSRRKVLLVDDDVSHRQVMRAMLSPLGFEIVDLGNALQVLATVE
AERPDLVLLDVSMPGQSGWEVLAMLRQHKHTMPVVMVSADANEGHHAADSPRLHDGYIIK
PVRLNLLLDTIASVLDLNWRFDKSPDPMAAIPAPDHGVLPLPKMEHRLALATLARIGHRK
GLLEALHDLKHSGEAAEPFAIELTRLTNDFQFEKILELLEVAEHEAS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaagacagaatatttttcgggttcggcgcagctacaaccagtgggtagccaac
cagaccctggaagactatgcgcttcgctttaccgccaagagtgcccggcgctggtccgcg
gctcgggtaagcaacacagccctgggcgccatctcctttctggcgctggaagccatcggc
ggctccattaccctccactacggattcgacaatgcggtcgccgcgatactggccgtcagt
ctggtgatcttcctcaccgccatcccgatcagttactacgcggcccgttatggcgtcgac
attgacctgctgactcgcggtgccggctttggctatataggctccaccatcacctcgctg
atctacgcctcgttcacgtttatctttttcgccatcgaggccgccatcatggccatggcg
ctggaaatgctgttcggggttcccctggttctcggctacctgatctgtgccgtggtcatc
attccactggtcatacatggcatcaccacgatcagccgattccaggtctggacccagcca
gccttcatctttctccaactggtgccctttgttttcattgtttacgcggatgcctcttcc
gtcagcgactggacacagttcgaggggcttaacccggttgattcgggtggcttcagcatc
gttatgttcggggctgcggcggctgtcgtgttctcattgattgcccagatcggcgagcag
gtggatttcctgcgcttcattccagaaccccgcaatgcccgggaaaagcgacgttggtgg
gccgccgctatggcaggcggacctggctggattgtgatcggcatgttgaaaatcctggcg
ggctcctttcttgcggttcttgccctgaaacagggcgttaccgcctcggaggcggctgat
ccaacccagatgtatctgatcgccttcaattacattacccattcgcccgagatctccctg
gcgatggcgggcattttcgtcattctttgccagctcaagatcaacgttaccaatgcctat
gccggctccatcgcctggtccaacttcttctcgcgactcacccacagccaccccgggcga
gttgtctggctgtttttcaacgtcgccattgcccttctggtgatggaactgggtgtttac
cgggcgctggaggaaaccctgggtttctacggcatcgtcgccattgcctgggttggttcg
ctggtggcggatctggtgatcaacaaaccactggggctcagtcccgcacacattgagttc
aaacgtgcccacctgtacgacatcaacccggtcggggttggtgccatgctgacggcctct
gtagtaggcatcatctgccacaccggcatactgggcgtctatccggaggctctatcccat
tttatcgccatgggagtcgcgctgatcatggcgcctctgatcgcctggaaaaccggtggc
cgtttctacacagcacggccattcgtccccatcgctactgaccatcagctcgtgcaatgc
acgatttgtgaacatcacttcgagccggaagatctcacccattgtcccgcgtatgacggc
accatctgttcactgtgctgttcgctcgatgcccgttgcgcagacgcctgcaaaccgggg
gccggatatcaggaacagctcaatcagtttctcgggagcctgatgccaaaaccggtgttg
gccggtctgcgctcaaggctcgggcattttctgagcctgctggtgctcatcaacggcctt
tccggcctgctgctgtccctgatctatttcaagacgccggtcgcttcacctgcggaaggc
cttcttttatcggtaaccctgtggaaggtgttcttcattctggtgatcgtgaccggtgtg
atctgctggctgttcgtgctcgcccatgaaagccgggtagtcgccgaggaagagtcccga
cgccagaaccgcctcctgatggaagagatcgtcgcccacgaacggaccgaccaggctctt
cagcaggcaaaggaacaggcggaggccgccaacggggcgaaaagtcgctacttgacgggg
atcagtcacgaactccgttccccactcaatgccatcctcggttatgcccagttgatggaa
aacgacgagaccatcccttcccaccgcaaggaagccctcggcgtgatacgccgaagcggt
gagtacctcgccgatctgatcgaggggctgctggatatttccaaaattgaagccggccgg
ctggacctgcaccgcgatcaggtcaggattgggctgctgatggagcaactggtgaccatg
ttccgcctgcaggcagaagataaaggcctggccttcgattaccactgccccaacccgctt
ccggaaatggtcaccaccgacgagaagcggctgcgccagattctgatcaaccttctctcc
aacgccattaaatacacggatcggggaggcgtctccctgaccctgcgttatcgcagtcag
gtcgccgagttcaccgtacgcgataccggggaaggcatagcccctgagaatgtggaacgc
atcttccgacccttcgaacgtatccggacaccggggcaaagccgggccggcacaggtctg
ggtctgaccattacccgcctgctcacggaaatcatgggtggcgatatctcgctggaaagc
gtaccgggccagggtagtgtcttccgggtcagtctgatgctatcaagcctgcattcttcg
acaccccgctcgatatcaatgccggccaagcgcatctacggttaccacggttcgcggcga
aaggtactgctggtggatgacgatgtgtcccatcgccaggtcatgcgggccatgctctcg
ccactgggctttgaaatcgtcgatcttggcaatgctctgcaggttttggcaaccgttgag
gcggaacgccctgaccttgtgcttctcgacgtgtccatgccgggccaaagcggctgggaa
gtcctggcaatgctacgacagcacaagcacaccatgcctgtcgtgatggtctctgccgac
gctaacgagggccaccacgccgcagactcaccgcgtctgcacgatggctacatcatcaaa
ccggttcggctgaacctgttgctcgacaccattgccagcgtgctggatctcaattggcga
ttcgataagagcccggatcccatggcggctattccagcacccgaccatggcgttttgcct
ttacccaaaatggagcatcgcctggctctggccactctggcccggatcggacaccggaaa
ggcctgcttgaggcattgcatgacctgaaacacagcggcgaggcggccgaaccctttgcg
attgagctcaccagactcaccaatgatttccagtttgagaaaattcttgaactactcgag
gtagccgaacatgaagcttcataa

DBGET integrated database retrieval system