KEGG   Marinobacter adhaerens: HP15_3808Help
Entry
HP15_3808         CDS       T01922                                 

Definition
(GenBank) multi-sensor hybrid histidine kinase
  KO
K20971  two-component system, sensor histidine kinase LadS
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_3808
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_3808
Protein kinases [BR:mad01001]
 Histidine kinases
  Other
   HP15_3808
Two-component system [BR:mad02022]
 Other families
  Unclassified
   HP15_3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg 7TMR-DISM_7TM 7TMR-DISMED2 HATPase_c HisKA PAS Hpt PAS_9 PAS_8 PAS_4 PAS_3 HATPase_c_3 DUF1772
Motif
Other DBs
NCBI-ProteinID: ADP99572
UniProt: E4PIX4
LinkDB All DBs
Position
4033281..4036781
Genome map
AA seq 1166 aa AA seqDB search
MTSLVAVLLFLVTAMMPASASAAGPCHDGEIVLDGGIESIRDLGGCIWYLEDPGQELTLD
EVRALESGAFTRHEGGVLNFGYTESAYWVRLDLRSVGNPDQNGWILELALPLVDEVTLFM
VRDGDLVDQRQAGYEDNWVERDLAVPNPTFRLSLAPDSLSHVYLRVVNTNTFRLPISLWH
PDSYIEKVSVDELVRGILLGSVLAILAYNLFVAVSVRERSNIYYVLYLVFAAIFIFTEQV
HGIQLLDSRPALFDKQFLHFQIILTWFWGLLMARSLLETRERSADLDQVIRLCLYSVVAT
FVLSLFLPYHVAMEWIVVGSILLSLILIVVSYLSWRYYNPAARSYFFAWTLALVGFGIYA
LTVMGILPLNTFTAYSPQFGLTAQIILFSFALADRIKQVQGEALGWSQRALSNLQRYQSL
FDNAIEGVFQMSPDRRFVTANPAMARLLGYNSSRELLKRNPDVLETCIADERLRRLVIEQ
LEARGTVKGIEARYLTRDGDERWATISLHTVYDTEGEPTHLEGTCIDATESHNRLRIERE
REQERLEKELARNSAEAKSQFLANMSHEIRTPLAAIIGYGETLLDPDLSEPEKRSSAETV
VRSGRHLLDLVNDILDHSKIDANKLDVDIVSVNLPELLDEIRAFFAPRAREKGLDFSIIC
EYPLPEQVRTDPTRLRQIIINLCGNALKFTDKGSISLVVRCDRDQELLVARVVDTGIGMK
PEQLGRLFDPFAQGSAAISRQYGGTGLGLSISRRLAEMLGGSIRVNSTYGEGSEFELSIR
TGPLDEVHFLRDASELSQRRRTIPMVVAPRLSGRILCAEDNEVNRRLVSLLVSRTGAELV
HVSNGAEALELAIREPFDLILMDIQMPVMNGRDATAALREAGVNTPVIALTANVMSEDIA
DYRLAGCNEHLAKPIDKQRFYETLGRYLSVTPASANERTSRYQGKVLVAEDNTENRQLVE
RMLRREGLDVVAVTGGEDAVRTALSDTVHLVLMDRHMPGMDGVDATRLLRQAGFRRPVIA
FTAGDQQETDALLEAGCDGVLNKPIDQSHLTALLDRLLGTGPVFAADTGEDAEIAHLVAQ
FLDGLAARRTRMDAALADADREAMKTEAHQIKGTAGAMGYPLMTRQAGILEELLKVTEPD
WERVRSELKELGEMIDRALAAAKTPG
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctttggtagcggtcctgctgttcctggtcacggccatgatgccggcgtcggcc
agtgcggccgggccctgccatgatggcgagattgtactggacggcggtatcgagagtatc
cgtgatctgggtggctgcatctggtatctcgaggacccggggcaggaactgaccctcgat
gaggttcgcgctctcgaatcgggtgcctttacccgccacgaaggcggtgtgttgaacttc
ggctacacggaatccgcatattgggtgcgcctggatctccgctccgtgggcaatcctgac
cagaacggatggatccttgagcttgccctgcctctggtggatgaagtcaccctgttcatg
gtccgcgacggggatctggttgatcagcgacaggcgggttatgaggacaactgggtggaa
cgggacctcgccgtccccaacccgacattccgcctttcactggcaccggattccctgagc
cacgtctacttgcgggtggtcaacaccaatactttccgtctgccgatcagcctctggcac
ccggacagctacattgaaaaagtctcggtggatgagctggtgcggggcatcctgcttggt
tcggtgctggccattcttgcctacaacctgttcgtcgcggtctcggttcgcgagcggagc
aacatctattacgtgctctacctggtctttgcggccatctttatcttcaccgaacaggtt
cacggtatccagcttctcgacagccggcccgctctgttcgacaagcagttcctgcacttc
cagatcattctgacctggttctggggcctgctgatggcaaggtcgctgcttgaaacccgg
gaacggtcggccgatcttgatcaggtcatccgcctgtgcctgtattcggtggttgccact
ttcgtgctgtcgctgttcctgccctaccacgtcgccatggaatggattgtggttggctcc
attctgctgagcctgattctgatcgtggtcagttacctgtcctggcgctattacaatccg
gcggcccgttcctattttttcgcctggacactggcgctggtgggcttcggtatctatgcc
ctgacggtgatgggcatactgccattgaacaccttcaccgcttactcaccccagtttggt
ctgaccgcccagatcatcctgttttcttttgccctcgccgacaggatcaaacaggtccag
ggcgaggccctgggctggagccagcgggcgctgtcgaaccttcagcgttaccagtcgctg
ttcgataacgccatcgagggcgtgttccagatgtcgccggaccggcgatttgtcacggcc
aatcccgccatggcgcgcctgctgggctataacagcagccgcgagttgctcaagcggaac
ccggacgtactggaaacctgcatcgccgacgagcggttgcggcggctggtgatcgagcag
ctggaggcccggggcacggtcaagggcattgaggcccgatacctgacccgggacggtgac
gagcgctgggcgaccatctcactgcatacggtgtatgacaccgagggtgagccgacccat
ctggaaggcacctgcatcgacgccaccgaaagtcacaatcgcttgaggatcgagagggag
cgcgagcaggagcgtcttgagaaggagcttgcccgcaattccgcggaggcgaaaagccag
ttcctggccaatatgagccatgagatccgcacaccgctggcagccatcatcggttacgga
gaaacgctgcttgatccggatctcagtgaaccggagaaaagaagcagtgccgagacggtg
gtgcgcagcggccgacatctgctggacctggtcaacgacatcctcgaccactcgaaaatc
gacgccaacaaactggatgtggacatcgtatcggtcaatctgccggagcttcttgatgag
attcgcgccttcttcgcgccaagagcccgggaaaaaggactggatttcagcatcatctgc
gaatacccgttgccggagcaggtacgcaccgaccccacccgactgcgccagatcatcatc
aacctgtgtggtaatgcccttaaatttaccgataaggggtccatttccctggtggtccgt
tgtgatcgcgatcaggaattgctcgtggcccgggtcgtggataccggcattggcatgaag
ccggagcaattggggcggctgttcgatccctttgcccagggcagcgccgccatttccagg
caatatggtggcactggcctcgggctcagcatttcccggcgtctggcggaaatgcttggc
ggcagtatccgggtgaacagcacctatggcgagggcagcgagtttgagctttcgatccgg
acagggccactggatgaggtgcatttcctgcgcgatgcctcggagctgagccagcgccgc
cggaccatccccatggttgtcgcgccgcgattgtcagggcgtatcctgtgtgccgaggac
aacgaggtgaaccggcggcttgtttccctgctggtgtctcgaaccggagccgagcttgtc
catgtgagcaacggagcggaagccctggaattggcgattcgcgaaccctttgatctgatc
ctgatggacatacagatgccggtgatgaacggccgtgacgccacggcggcacttcgagaa
gccggggtgaatacgccggtcatcgcgctcaccgccaatgtgatgtccgaggacattgcc
gactatcgcctggccggctgcaatgaacacctggcgaagcccatcgacaagcagcgcttc
tatgaaacactgggacgatacctgtcggtgacgccggcctccgctaatgaacgaacctca
cgctatcagggcaaggtgctggttgccgaagacaacacggaaaaccggcagctggtagag
cgtatgctgcgccgggaaggtctggacgtcgtggcagtgaccggcggcgaggacgcggtt
cggactgcattgtctgatacggttcatctggtgctgatggaccgtcacatgccgggaatg
gatggtgttgatgccaccaggttgctgcgccaggccgggttccgccggccggtgattgcc
tttacagccggcgatcagcaggaaaccgatgcattgcttgaggccggttgtgacggcgtg
ctgaacaagcccattgatcagtcccacctgacggccctactggatcggctgctgggcacg
ggccccgttttcgccgcggataccggtgaagacgctgaaattgcccacctggtggcacag
tttcttgacgggcttgccgcgcggcggacccgaatggatgccgcgctggcggacgcagat
cgtgaagcaatgaaaaccgaagcccaccagatcaagggcacggcgggtgccatgggctat
ccgctgatgacccgacaggcgggtatactggaagagctgctgaaagtcactgagccggac
tgggaacgtgttcgcagcgaactgaaggaactcggtgaaatgatagaccgtgccctcgcc
gctgcgaaaacgccaggctga

DBGET integrated database retrieval system