KEGG   Marinobacter adhaerens: HP15_3962Help
Entry
HP15_3962         CDS       T01922                                 

Definition
(GenBank) two-component system sensor histidine kinase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA PBP1_TM HATPase_c_3 HATPase_c_2 DUF1772
Motif
Other DBs
NCBI-ProteinID: ADP99726
UniProt: E4PKQ4
LinkDB All DBs
Position
4191312..4192730
Genome map
AA seq 472 aa AA seqDB search
MRLWPRRAGGQLALLLILVLLVAQVITIVILAGERQGALRSASLEHVLQRVADGYTLADT
TDPERQERILRALSSPTLRLSIDPAPYLTEDQSSDMRRRLAEELGLPMAQVRTAMEADGD
DCLRDRDDHRDRERHDDEDDEHHEYEEHRDDDDHHDDRHECPPVLGVSLALSSGQWFNAR
ARPPAPSWLWLKATLTSVGITAVLLTLTLLLAVRRILRPMNELSQAAHAFGRGEKVRIPE
KGPEDVREVTRAFNQMQDQVGRAQEDRARLLAALAHDLRTPITSMRLRVEMLPEGEDRDR
LLDSLREMQHLAEATLDFIRGTTTEQHRRYDLATLLDSLCGDLQEMGLAVHCDDSPRCVL
QGQPEAVKRALRNLIENAVNYGEQAEVTLATTDTEAVVTIVDQGPGILEADRERVFEPFY
RLEHSRSRETGGAGLGLAIARTLIRGMGGDIRLDAGPGGQGLQVSVTLPKTR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtggccacggcgcgccggtgggcagctggcgctgttattgattctggtgctg
ctggtggcccaggttatcaccatcgttattctggcgggtgagcgccagggagcgttgcgc
agtgccagtctggaacacgtcctccagcgggtggccgatggctataccctggccgatact
accgatccggaacggcaggagcgcatcctccgggcactctccagcccgaccctgcggctt
tccattgatcccgcgccctatctgaccgaggatcagtcctccgacatgaggcgcaggctg
gccgaggagctgggtctgcccatggcgcaggttcgaacggccatggaggctgatggagac
gactgcctgcgggatcgcgatgatcatcgggaccgtgaacggcatgacgatgaggatgat
gaacaccacgagtatgaagaacaccgtgatgatgacgaccatcacgatgaccggcacgaa
tgcccgccggtgctgggtgtttccctggcgctgtcttccggccagtggttcaatgcccgg
gcccggccaccggcgccctcctggctgtggctaaaggcgacgctcaccagcgttggtatt
accgcagtgctgctcacgctgaccttattgctggcggtccgtcgaatactgcggccaatg
aacgagttgagtcaggcggcccacgcgttcgggcggggggagaaagtccggattcctgaa
aagggaccggaggatgttcgtgaggttacccgcgccttcaaccagatgcaggatcaggtt
ggccgcgcccaggaagaccgggcaaggctgctggcggctctcgctcacgacctcaggaca
cccattacctccatgcggctccgagtggaaatgctgccggaaggtgaggacagggaccgt
cttctcgattccctcagggaaatgcagcatcttgccgaagccaccctcgatttcatccgg
ggcaccaccaccgaacagcaccgtcgctatgatctggcgaccctgctggacagcctgtgt
ggtgatctccaggaaatgggcttggcggtgcactgcgatgacagcccgagatgtgtactc
caggggcagcccgaagccgtcaaacgtgccctgcgtaatttgattgagaacgcggttaat
tatggcgagcaggcggaagtaacactggcaaccacagacacagaagcggttgtcacgatt
gttgatcaggggccgggtattctggaggcggaccgggaacgggtttttgaacccttctat
cggctggaacactcacgcagccgcgaaaccggtggcgcaggcctgggcctggctattgcc
cgtaccctgattcgggggatgggtggcgatatccggctggatgctggcccgggaggtcag
ggcctgcaggtttctgtgactttgcccaaaaccaggtaa

DBGET integrated database retrieval system