KEGG   Marinobacter adhaerens: HP15_3967Help
Entry
HP15_3967         CDS       T01922                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
mad02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_3967
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HP15_3967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_3967
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_3967
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_3967
Protein kinases [BR:mad01001]
 Histidine kinases
  OmpR family
   HP15_3967
Two-component system [BR:mad02022]
 OmpR family
  QseC-QseB (quorum sensing)
   HP15_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HATPase_c_2 HAMP DUF948
Motif
Other DBs
NCBI-ProteinID: ADP99731
UniProt: E4PKQ9
LinkDB All DBs
Position
complement(4196290..4197702)
Genome map
AA seq 470 aa AA seqDB search
MSLTRKLILLITSTVFFITLIAAGWGFYVSDHQLEELFDAELAQSTRIVQGLVEHLSSTQ
SMEQISHTLEKTLQLPDGVYQGDEEENEILPGGAGHKYERKLAFEVWSPDREPILDTLRA
NDSQGLERGFGWQEVAGYQWRTFTLEDPATGFWIRTAQREDVRDELSQEIALGNVLPFLI
VLPVLALAVLVSIQVGFQPLRKLEKPVRNMAPENIHPLDDRQAPKEVAGLVQAVNGLLRR
LNQALERERRFSADAAHELRTPLTALRLNLEKVYENDPEQYGDLIQSVDRMVHLVEQMLL
LNRVDSGADFTPEYHNLSAIVEQSIADVAPLALKKDIDPVLQDDAGQALVSCHSALINTL
MRSLLANAIQYSPEHTSIETHLTPAGEGYHITVCDQGPGIPAEARERALSRFVRLDQRLG
GGAGLGLAIARRIAELHGGQLTLGDRPDGNSGLCVSIWLPARATSRLKKV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacccgaaaactgatccttctgatcaccagcacggtgttcttcatcactctg
attgctgccggctggggcttctacgtcagcgaccatcaactggaagagcttttcgacgcg
gagcttgcccagagcacccgcattgtccagggcctggttgagcatctctcttccacgcag
tcgatggagcagatcagtcataccctggagaagacgctccaactgccagacggcgtgtac
cagggcgacgaggaggagaatgaaatcctgcccggcggcgcgggccacaaatacgaacgg
aagctggcctttgaggtctggtcgccggaccgggagccgattctggacaccctgcgcgcc
aacgattcgcagggcctggagcgtggtttcggatggcaggaagtagccggatatcaatgg
cgaaccttcacccttgaagatccggcgaccggtttctggatccgcacggcccagcgtgaa
gatgtccgggatgaactcagccaggaaatcgctctcggcaacgtactgcctttcctgatc
gtgctgcccgtgctggctctggcagtgctggtgtcgatccaggtgggcttccagccactt
agaaagctcgagaagcccgtacgcaacatggccccggaaaatatacacccactggacgac
cggcaggcgcccaaggaagtcgccggtctggtgcaggcggtgaatggtctgctccggcgc
ctcaaccaggccctggaacgagagaggcggttttctgccgatgccgcccacgaactgagg
acaccgctcacggccctgcgcctgaatctggaaaaagtctacgagaacgacccggagcaa
tacggcgatctgatccagtccgtggaccgcatggtgcacctggtcgagcagatgctgctg
ctcaaccgcgtcgactctggtgccgatttcaccccggaataccacaacctgtctgccatc
gtggaacagagcattgccgatgtggcaccgctggccctgaaaaaggacatcgaccccgtg
ctgcaggacgatgccggtcaggccctggtctcctgccacagtgccttgatcaacaccctc
atgcgctccctgctggcgaacgccatccagtacagccccgaacacacaagcatcgaaaca
cacctcacgcctgccggtgagggataccatataaccgtgtgcgaccagggccccggcatc
ccagccgaggcacgtgagcgggctttgagccgttttgtccggctggaccagcgactcggt
ggtggcgcgggtctcgggctggccatcgccaggcgcatcgctgaacttcatggtggccag
ctcaccctgggcgaccggccggatggcaactcgggcctgtgcgtcagcatctggctcccg
gcccgtgccacctctcgtctcaagaaggtttaa

DBGET integrated database retrieval system