KEGG   Marinobacter adhaerens: HP15_3982Help
Entry
HP15_3982         CDS       T01922                                 

Definition
(GenBank) sensor signal transduction histidine kinase-like protein
  KO
K15011  two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_3982
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_3982
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_3982
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_3982
Protein kinases [BR:mad01001]
 Histidine kinases
  Other
   HP15_3982
Two-component system [BR:mad02022]
 Other families
  RegB-RegA (redox response)
   HP15_3982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_3 HisKA
Motif
Other DBs
NCBI-ProteinID: ADP99746
UniProt: E4PKS4
LinkDB All DBs
Position
complement(4213692..4214963)
Genome map
AA seq 423 aa AA seqDB search
MEWLTHSQTGFQQTARYLLGMRLAIVALQLISIAVAETMVTLAHRAEAVILPLAYGVMAT
LAWLWFTRRPPRSTQAVSLVLIVDLLLIGVWLYLTGGYTNPLVSLLLLPIAVAIVLVPLG
QSIAVTVAGVAVYTSLVIWHTPVTHGHHNANLAQLHLVGMWVTFATTAAILLLVVGALAR
RLRQQQAQLAQIRETRLRDEQIIALGLSAAAVAHRLGTPLNTMTLLVEEMKSAAPVGDPI
ADDLTLMESQLGLCTTHLQQLSSAAVQAKTAQLETLPARDWVARLRESATLLWPGAAIEW
RQPVPDCPVAVDATLDQAVLNVLANAVTASPSWVAVAASEGADGRLELVVEDHGDGLEST
PEGTLGDKVVSSENGLGVGLFLSNATIQRLGGTLKARGSADGTTIIIELPITTATNGLAG
EQA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaatggctgacccactcacagaccggatttcaacagactgcccgctatctgctgggc
atgcgtctggctattgttgcgctgcagcttatttcgatcgccgtggcggaaaccatggta
accctggcccatcgggctgaagcggttatcctgcccctcgcctatggggttatggcaacc
ctggcctggctctggtttacccgtcgcccaccgcgctcgacacaggccgtcagcctggtg
ctgattgtcgatttgcttttgatcggagtctggctttacctgacgggcggctataccaac
cccctggtttccctgttgctgctgcctatcgccgttgccattgtgctggtgccactgggc
cagagcattgccgttaccgtcgccggcgttgcggtttatacctccctggtgatctggcat
acgccggtcacccatggacatcacaacgccaacctggcccagttacacctggtcggcatg
tgggtgaccttcgccacaaccgctgccatcctgctgctggttgtcggtgccctggcacgt
cgcctgcgccagcaacaggcccagctcgcacagatacgggaaacccggctgcgagatgag
cagatcatcgccctcggactgtcggctgctgcagtggcacatcgcctggggacgccgctg
aacaccatgacgctgctggtggaggaaatgaaatccgctgccccggtcggcgaccccatc
gccgacgacctcacactgatggaaagtcaactgggcctgtgcacgacccacctgcaacag
ctgtcttcggcggccgtgcaggccaagaccgcgcaactggaaaccctgccagcccgggac
tgggtggcacgtcttcgggaatccgctaccctgctttggccgggtgccgccattgaatgg
cgtcagcctgtgccggactgcccggttgccgtggacgccacccttgatcaggccgttctg
aatgtgttggccaacgcagtaacagccagcccgtcctgggtcgccgttgcagccagtgag
ggtgccgatggccggctggaactggttgtcgaggaccatggcgatggcctggaatccacc
ccggaaggtacgctcggggacaaggtggtcagttcggagaatgggctcggagttggcctt
ttcctttccaacgccaccatccagcgtcttggaggcacactgaaagcccggggtagtgcg
gacggtaccaccatcatcatagagctgccgataacgacagcgaccaacggcctagcggga
gaacaggcgtga

DBGET integrated database retrieval system