KEGG   Marinobacter adhaerens: HP15_426Help
Entry
HP15_426          CDS       T01922                                 

Definition
(GenBank) signal transduction histidine kinase, nitrogen specific, NtrB
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_426
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_426
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_426
Protein kinases [BR:mad01001]
 Histidine kinases
  NtrC family
   HP15_426
Two-component system [BR:mad02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   HP15_426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HATPase_c PAS PAS_4 PAS_9 PAS_8 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ADP96190
UniProt: E4PMR2
LinkDB All DBs
Position
complement(424158..425252)
Genome map
AA seq 364 aa AA seqDB search
MALPSAHPTGYKSILDSLTTAVLVLEDSLAIQYLNPAAESLFETSMTRSQGQPFQDILVE
SEDALKTLFAAVRNGQSYTRREAEFLLTSGSRLTVDYSVTPISLEPTELLIEIQPRDRLM
RISREEDIISQQETTRILVRGMAHEIKNPLGGIRGAAQLLDRELSSEDQREYTRVIIDEA
DRLRSLVDRMLGPNKALKLAPTNIHEILERVGTLLEAESKGRLNFERDYDPSIPEFKGDK
EQLIQAFLNIARNAMEAAFENQGGHSSEEPPTITFRTRTLRQFTIGNRRHKLVCRVDVID
NGPGIPPELVQNIFYPMISGRASGTGLGLSITQSIIGQHRGLVECESEPGRTDFIIFLPL
EDTP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccctcggcccatccaacgggatacaagagcattctcgacagcctcaccacg
gctgttctcgtgctcgaggatagcctggctatccagtacctcaacccggccgcagaaagc
ctgttcgaaaccagcatgacccgcagccagggccaacctttccaggatattctggtcgaa
tccgaagacgccctgaaaacccttttcgccgccgttcggaacgggcaatcctacactcgc
agagaggctgagtttctgcttacgagcggttcacgacttacggtggattattccgtaacg
cctatcagcctggagccgacggaactgctgatcgaaatccagcccagggacaggctgatg
cggatcagccgtgaggaagacatcatctcccagcaggagaccacccgtatcctggtgcgg
ggcatggcccacgagatcaagaatccgctgggcggcatccggggcgcagcccagctgctt
gaccgggaactcagcagtgaagaccagcgggaatacacgcgggtcatcattgacgaggcg
gaccgcctcagaagccttgttgaccggatgctgggccccaacaaggcactgaagctggcg
ccgaccaacatccatgaaatcctggaaagagtgggcaccctgctcgaggcggaaagcaaa
gggcgactgaatttcgaacgggattacgaccccagcattcccgagttcaagggcgacaag
gaacaactcattcaggcgttcctgaatattgcccggaacgccatggaggcggcttttgaa
aaccagggcggtcacagctctgaagagcctccgaccattaccttccgcacccgcaccctg
cgtcagttcaccattggcaaccgccgccacaaactggtgtgtcgggtcgacgtgatcgac
aacggacccggaattccgccggagctggtgcagaacattttctatccgatgatcagtggc
cgtgccagtggcaccggtctggggctctccatcacccagagcatcatcggtcaacaccgc
ggactggttgaatgcgaaagcgaaccaggccgaaccgacttcatcatcttcctgcctctg
gaggacaccccatga

DBGET integrated database retrieval system