KEGG   Marinobacter adhaerens: HP15_524Help
Entry
HP15_524          CDS       T01922                                 

Definition
(GenBank) signal transduction histidine kinase, nitrogen specific, NtrB
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_524
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_524
   02035 Bacterial motility proteins [BR:mad02035]
    HP15_524
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_524
Protein kinases [BR:mad01001]
 Histidine kinases
  NtrC family
   HP15_524
Two-component system [BR:mad02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   HP15_524
Bacterial motility proteins [BR:mad02035]
 Pilus system
  Twitching motility proteins
   HP15_524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HATPase_c PAS HATPase_c_2 PAS_8 PAS_4 DUF4282 DUF4577 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ADP96288
UniProt: E4PNH0
LinkDB All DBs
Position
complement(537999..539654)
Genome map
AA seq 551 aa AA seqDB search
MAADTPVRSAEALGPAPSTPPGIQQAKLFRIYNHYRLVVSLMLVALLFVDPVNFDMRFRL
LDYYQAGVSAYLGLNAFIALLLIAGFHPSQRHITLSILLDILIMHGLLLASTGITNGLAN
LVIVSVAAGNILTPSRMGTFYAALAAICSLGISGWAVLTLGESADDIVRAGSLGILYFAA
AFVLQSISRRMMRSEALATSRARSIAELEKINQQIIQRMRTGILVLDRFGQIRLANAAAE
ELLYGAPKASAPIHERATVLPKPLKQGLDAWLKDPTQRIEPFQPSPTSPLLQVNFTQLDQ
ERGDQILVFIEDMSKVTQQAQQMKLASLGRLTAGIAHEIRNPLGAISHAAQLMEESPNLD
PGDHQMLGIIRRHSRRVNGIIENVLDLSRRRAANADLIEVAPWLQEFKEDFLQTQNEGRA
EADIILKIDPQLPSARFDKSQIEQVMVNLCDNGLRYSEQHSGQRRIGIHAGATEDGERTY
IDVRDQGPGIAPEHRNSVFEPFFTTDKTGTGLGLYLARELCEANQAHLSLVEDNKPGCCF
RITFAHPGRMI
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatacaccagtacgatcggccgaagcgctcggcccggccccttcgacaccg
cccggaatccaacaggccaagctgttcaggatctacaaccactaccgactagtggtgagc
ctgatgctggtggcactgctattcgtggatcccgtcaactttgatatgcgcttccgactg
ctggattattatcaggccggcgtttccgcctacctcggcctgaacgcgtttattgcgttg
cttctgatcgccggatttcaccccagccagcgccacataacactttcaatcctgctggac
attctgatcatgcatggcctgttgctcgccagcacaggcattaccaacggccttgccaac
ctggtgattgtgtcggtggccgcgggcaacattctgacgccaagccgcatgggaaccttc
tatgcagcgctggcagccatctgctcccttgggatctcaggatgggcagttctgaccctc
ggagagtcggctgacgatattgttcgagccggttcactgggtatcctctactttgcagcc
gctttcgtcctgcaaagcatctcccggcgaatgatgcgcagcgaggcattggctaccagc
cgcgcccggagcatcgctgaacttgagaaaatcaaccagcagatcattcaacgcatgcgc
accggcattctggtgctcgaccgtttcggccagatccgccttgccaacgccgccgccgaa
gagctcttatacggcgcccccaaagcctcggcaccgattcacgagcgagcgaccgttttg
ccaaagcccctcaaacagggcctggacgcatggctaaaggacccgacacagcgcatcgaa
ccctttcaaccctcacccacctcgccgctattgcaggtcaactttactcagctggaccag
gagcgaggcgaccagatccttgtattcatcgaagatatgagcaaagtcacccaacaggcc
cagcaaatgaagctggcatcgctgggcagactcacggccggcattgcccatgaaatccgc
aatccgctgggggcgatcagccacgcggcccagctcatggaggaatcccctaacctcgac
ccaggtgatcatcagatgctcgggatcatccggcgccattcgcggcgggtgaatggcatc
atcgagaacgtgcttgatctttcaaggcgtcgagctgccaacgcagatctgatcgaagtt
gctccatggctacaggaattcaaagaagactttctgcaaacgcagaatgaaggccgcgct
gaggccgacattattcttaaaatcgatccccaactgccatctgcgagattcgacaagagc
cagattgaacaggtcatggtgaatctttgcgacaacgggctacgctacagtgaacagcac
tcggggcaacgaagaatcggcatccatgcgggggcaactgaggacggagagcgaacctat
attgatgtccgcgaccagggccctggcattgcacccgagcacagaaattctgtgttcgaa
ccctttttcaccacagacaagaccggaaccgggctcggactttatctggcccgggaactg
tgcgaggctaatcaggcccatctttcgctggtagaagataacaaacccggctgctgtttt
cgcattacatttgctcatccggggcggatgatctga

DBGET integrated database retrieval system