KEGG   Marinobacter adhaerens: HP15_747Help
Entry
HP15_747          CDS       T01922                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_747
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_747
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_747
Protein kinases [BR:mad01001]
 Histidine kinases
  OmpR family
   HP15_747
Two-component system [BR:mad02022]
 OmpR family
  RstB-RstA
   HP15_747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HAMP SCAB_CC HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ADP96511
UniProt: E4PQG8
LinkDB All DBs
Position
755407..756882
Genome map
AA seq 491 aa AA seqDB search
MRSQFWHERFPEPLMRWLAAAPAPLQQYHWLSSTVDLRMGAASRFNLSPVALERLGYGQV
VGIDSDVGYRVLVTGLSGEILQLRLNEPYRDVSETIGLIFRWHLDSASADDRLNVASQMA
RSLNVQVQTLDDADLLPDSDVLDQVAERGLAFYTDESDGCGRVIVQLSDGELYRIDMPAG
FDPWAWPVVLLLVLVLGGVLAVAVFLALREVDSNLRTVESVAVRIARGEMSARVQAGEGT
LVTRLASSFNGMAEHIQRLVQVQREMIHAVSHELRTPVARIRFGVQMIEDCQDEAALQRQ
LDGIDGDIQELDELIDEILTYARLEQGGPVFSLQETSITDIVRQVVSEQQMVRPELSIEG
NIDEVSERWALSDIEPRYLHRAIQNLVGNAGRYAAGKVLVSCHFDEDNCRVDVEDDGPGI
PEEDWEKVFTAFARLDDSRTRTSGGYGLGLSIVRRILYWHGGHAFVSRSDTLGGAKFSLV
WPRKKPVDSIV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctcccaattctggcatgaacgcttccccgagccactgatgcgctggctggctgcg
gccccggcaccgttacagcaataccactggctgagttcgacggttgatcttcgcatgggg
gctgcttcccgtttcaacctgtcaccggtggctctggagcgacttggctacggccaggtg
gttggcatcgacagtgacgttgggtatcgggttctggtaaccggactgagcggagaaatc
ctgcagctgcgcctgaacgagccctaccgggatgtgtcagaaaccattgggttgattttc
cggtggcatcttgattcagcctctgcggatgatcgtctcaatgttgcctcgcaaatggcc
cgttctctcaatgtccaagtgcagaccctggacgacgccgacctgctgccggactctgac
gttctggaccaggtcgccgagcggggcctcgccttctacaccgacgaatcagacggttgc
ggacgggtgatcgttcagctatctgacggtgagttgtaccggattgacatgcccgcgggg
tttgatccctgggcctggccggttgtcctgctgctggtcctggtgcttggcggggttttg
gccgttgccgttttcctcgcgctccgggaagtggacagtaatctcagaaccgttgagtcg
gtagcggttcgaatcgcacgtggagaaatgagcgcccgggtccaggcgggcgagggaacg
ctggtaacccgtctggcctcgtcattcaacggtatggccgaacacatacagcgcctggtg
caggtgcagcgggaaatgattcacgcggtttcgcacgaattgcgcactcccgtggcccgt
atccgctttggcgtccagatgatcgaggactgccaggacgaggctgccctgcaaaggcaa
ctggacggtattgatggcgatatccaggaactggacgagctgattgatgagatcctgacc
tatgcgcggctggagcagggcggcccggttttctcgctacaggaaacctcgataaccgac
attgtccgccaggtggtctctgagcagcagatggttcggcccgagctgagtatcgaaggc
aacattgatgaggtctcggaacgttgggcgctgtcggatattgagcctcgctacctgcat
cgggcgatccagaatctggtaggcaacgcgggacgctacgcggctggcaaggtgctggtg
agctgtcatttcgatgaggacaactgtcgcgttgacgttgaagacgatggccccggcatt
ccagaggaagactgggagaaagtgtttactgcgtttgcccgactggacgacagccgtacc
cgaacctccggcggctacggcctgggtttgtctattgttcgccggattctctactggcac
ggagggcacgccttcgtcagcaggagcgacacgcttggcggtgcaaaattcagcctggtc
tggcccagaaaaaaacccgtggactccattgtgtga

DBGET integrated database retrieval system