KEGG   Marinobacter adhaerens: HP15_788Help
Entry
HP15_788          CDS       T01922                                 

Definition
(GenBank) multi-sensor hybrid histidine kinase
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_788
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mad02022]
    HP15_788
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HP15_788
Protein kinases [BR:mad01001]
 Histidine kinases
  NarL family
   HP15_788
Two-component system [BR:mad02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   HP15_788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c DUF2222 Response_reg HisKA Hpt HAMP Baculo_PEP_C OmpH
Motif
Other DBs
NCBI-ProteinID: ADP96552
UniProt: E4PQK9
LinkDB All DBs
Position
complement(798994..801867)
Genome map
AA seq 957 aa AA seqDB search
MRRWGIRKKVLVVTLVPTLLTTLMLGLFFTYSWVNNIESLLKDRGESLSRQLAAGSEYGL
FTANRSLLSSLSNALLEEQDVRSITFFGSDGSRLLHTGPGSSETVQATELTAEHATRISR
ENSTRFITPVFLQDLMIESMLDPDARQSMSNLREPLGWVVVEMSHIRTEKETYKALLISL
LLILGGVILSMAIALRLSRAFTNPVFELNEAVARLKEGKLDTRVYTGAGPEFEQLESGLN
AMAEELSKAQAEMQQNIDQATEDLRETLETIEIQNIELDFARKEALEASRIKSEFLANMS
HEIRTPLNGIIGFTELLLKSPLPRQQRDHLSTIRKSSEILLTIINDILDFSKIEAGKLIL
DRVPFQLRDIVEEVMVMLAPAAHAKNLDLVPLVYNDVPDNIMGDPLRVKQVITNLVNNAI
KFTQTGEVVLRASLEEEEADTNRVTLRLSITDSGVGLSRAQQQSLFNAFSQADASTARQY
GGTGLGLAISKRLVEEMGGKIGLESELGKGSTFWFTLTSELATSGEAIAPRDALRGERVI
YLEQQKTTGLAVEHLLRDWGMVVDRVASPGALQEHIEEAQKSQAGYAVAILGITRHLLNS
SQYCGLVRTLEIERDCRTLLLTPTLETHDTPLSGLASGHLTKPVCRDSLYDELLLLVHGI
NSGGRVPEYEISANRATTANVPRVLAVDDNDANLKLVMTLLEDCQLDAESASSGFEALSK
ARQKPFDLVFMDLQMPGMDGVETTARLREMDTGNHRTPIIALTAHALADEQERLTKQGFD
GYMPKPISSGQLNDIIHEYTGYVCPKNGSDGRLPVPEVRDTRRALRPSTRKMQQDCVSVD
ESIQLAAGKADLAEELFSMLLEQVHVDRGRISELWASHSMDELLECVHKLHGATRYCGVP
ELRAAANHLETAIKCSAPDLEHQKDQLLSAMERLQIWSDQTDWQQLFRERHEAAETT
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgttggggcattcgcaagaaagtgttggtggtaacgctggttcccaccctgctg
accaccctgatgctggggctgttcttcacctacagctgggttaacaatatagaaagcctg
ctgaaggatcggggcgaatcactctcccgtcagctcgccgccggttccgaatatggcctg
tttaccgccaatcgcagcctgctcagcagcctctccaatgcccttctggaagagcaggac
gtccgctccatcacgttctttggcagcgacggctcccgacttctccataccgggccgggt
agctccgagaccgtgcaagccactgaactcactgccgagcacgcaacccggatatcccgg
gaaaacagcacccgcttcattacccccgtttttctccaggatctgatgatcgagagcatg
ctggacccggatgctcgccagtcgatgtcgaatctgcgggagcctctgggctgggtagtt
gtggaaatgtcccatatccgcacggaaaaagagacctacaaagccctgctgatctcgctg
ctgctgattctcggcggcgtgattctgagcatggccattgcgctgcggctgagccgggcg
ttcaccaatccggtgttcgaactcaacgaagccgtagccaggctcaaggaaggtaagctg
gatacccgcgtctataccggcgcaggccctgagttcgagcaactggaatccggccttaat
gccatggcggaggagctgagcaaggcccaggctgaaatgcagcagaacattgatcaggcc
accgaagatctgcgggaaacgctggagaccatcgaaatccagaacatcgagctcgatttc
gctcgaaaagaagcactcgaggccagtcggatcaaatccgagttcctggccaacatgtcc
cacgaaatccgcacaccgctgaacggcatcataggtttcaccgaactgctcctgaagagt
ccgctgccacgccagcaacgggaccacctgagcaccatcaggaaatcgtcggagatcctg
ctcactatcatcaacgacatcctcgatttctcgaagattgaggccggcaagctgatcctc
gaccgggtaccgttccagttacgagatatcgtcgaggaagtcatggtcatgctggcgcca
gcggcacacgccaagaatctcgatctggtgccactggtctataacgatgtgccggacaac
atcatgggcgatcccctgcgggtcaaacaggtgatcaccaacctggtcaacaacgccatc
aagttcacccagaccggtgaggtggtcctgcgggcgagcctggaagaggaagaagctgac
accaaccgcgttaccctgcgcctgagcattaccgattccggcgtgggcctgtcccgggcc
caacagcaatccctgttcaacgccttcagccaggccgatgcctccaccgcccgtcaatat
ggtggcaccggccttgggctggccatctcgaagcgtctggtggaagaaatggggggcaag
atcgggctcgaaagcgagctgggtaaaggctccaccttctggtttaccctcacctcggag
cttgccaccagcggtgaagccattgccccaagggatgccctgagaggggaaagggtcatt
tacctggagcaacagaaaaccaccgggctggccgtggaacacctgttaagggactggggc
atggtggtcgaccgggtagcgtcaccgggcgccctgcaggaacacattgaagaggcccag
aaaagccaggcgggctatgccgtagcgattctgggcatcacccgacaccttctcaattcc
agccagtactgcgggcttgtccgtaccctcgagattgaacgggattgccggacactgcta
ttgacccccacccttgaaacccacgacacaccgctatcgggacttgccagcggccacctc
accaaaccggtgtgccgggattccctgtacgatgagcttttgctgctggtgcacggcatc
aattccggcgggcgggtccccgagtacgagatttccgccaaccgtgcaacgaccgccaat
gtgccgagagtgctggccgtggacgataacgatgccaacctcaagctcgtgatgacactg
ctcgaagactgccaactggatgccgaaagcgcttccagcggctttgaagccctgagcaag
gccagacagaaacccttcgacttggtcttcatggaccttcagatgcccggcatggacggg
gtggaaaccactgcaaggctgagggagatggataccggcaatcaccggaccccgatcatt
gcgttgactgcgcatgccctggcagacgagcaggaacgactgacaaagcagggcttcgat
ggctacatgcccaaacccatcagcagtggccagctcaacgacatcattcatgagtacacc
ggctacgtgtgcccgaagaacggcagcgacggccggcttcccgttccggaagttcgcgac
acccgtcgggcgctccggccttcaacacgcaaaatgcagcaggactgcgtcagcgtggac
gaaagcatccaactggccgccggcaaggcggacctggccgaagagctgttcagcatgctg
ctggagcaggtacatgtggatcgcgggcggatttcggaactctgggccagccacagcatg
gatgagctactggaatgtgttcacaagctccatggcgctacccgctactgcggcgtaccg
gaactgagagccgcagccaaccatctggaaacggccatcaaatgctctgctccggatctg
gagcaccagaaagaccagctgctctcggccatggagcgcctgcagatctggagcgaccag
accgattggcagcagctgttccgggaacgccatgaggccgccgaaacgacctga

DBGET integrated database retrieval system