KEGG   Marinobacter adhaerens: HP15_795Help
Entry
HP15_795          CDS       T01922                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mad  Marinobacter adhaerens
Pathway
mad00620  Pyruvate metabolism
mad00680  Methane metabolism
mad01100  Metabolic pathways
mad01120  Microbial metabolism in diverse environments
mad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP15_795 (ppc)
  Energy metabolism
   00680 Methane metabolism
    HP15_795 (ppc)
Enzymes [BR:mad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HP15_795 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADP96559
UniProt: E4PR24
LinkDB All DBs
Position
808402..811008
Genome map
AA seq 868 aa AA seqDB search
MLGELLGQSIRRYPGQECYELIEEIRAAAKSDRRQESGSGQRLVNLLRKLSDDELLPVTR
AFNQFLNLANLAEQYHGIRRKRGHQSDLMVESLGEVFERLKQGDVTPEELHQRVADLRIE
FVLTAHPTEVARRTLIMKYDEMSDCLARLDHDDLMPAEREEIVNRLSQLVTEAWHTDEIR
QERPTAVDEAKWGFAVIENSLWQALPQFLRSLDTSLEDATGKGLPLQASPIRIASWMGGD
RDGNPNVTHKVTRRVFLLGRWMAADLYLRDIQALRAELSMWQASDELKAVVGDSREPYRH
VLAELRERLIRTRDWAEASVNGETADANGILFENEDFTGPLELCYRSLVECGLEDIANGP
LLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVDYLGLGDYLSWSEQERQAFLVKELQ
GRRPLVPRNWEPSESVGEVLATCEVVAQQTPEALGSYVISMASKPSDVLSVILLLRESGM
KFPMRVVPLFETLDDLRGAPDSMSALYEVEWYREYCQGRQEVMIGYSDSSKDAGQLMAAW
AQYQAQEKLTHVARQYGVHLTLFHGRGGTVGRGGGPANRAILSQPPGSVNGSFRITEQGE
MIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPQPEDSWRETMDWLTERSLKAYRDVVREN
PDFVPYFRQVTPEQALGKLALGSRPARRKATGGVESLRAIPWIFAWTQMRLMLPSWLGSD
VALEEAARDHRLPVLREMMQGWPFFRTYVDMLEMVLAKADLRIASYYEQTLLDDDRLKAL
GESLRVRLQGCIERLLELKEQTDLLEGEPVFAHSMRVRNPYTDPLHYLQAELLRRDRESE
GKGEVPELVERALKVTMAGIAAGMRNTG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgaacttctgggccagagcatacggcggtatcccggacaggaatgctacgag
ctgattgaggaaatccgggcggctgccaagtccgaccgtcgccaggaaagcgggtccggc
cagcgactggtcaatctgctgcgcaagttgagcgatgatgagctgcttccggtgacccgt
gctttcaaccagttcctgaacctggccaaccttgccgagcagtaccatggtattcgtcgc
aaacgcgggcaccagtctgacctgatggtcgaatcgctcggggaggtgtttgagcggctc
aagcaaggtgatgtcacgccggaggaactgcatcagagggtggcggatctgcgaattgag
tttgtgctcacggcccaccccactgaggtggcgcgtcgcacccttattatgaaatacgac
gagatgtcggactgcctggcgcgtctggaccatgacgacctcatgcccgctgaacgggag
gaaatcgtcaatcgcctgtctcagctggttactgaagcctggcacaccgacgagattcgt
caggagcgaccaaccgcagtggatgaggccaaatggggctttgcggtcattgaaaacagt
ctgtggcaggccctgccacagtttctgaggagcctggatacgtcgctggaagacgcgacc
ggaaagggccttcccctgcaggcatcccccatccgcattgcatcctggatgggcggtgat
cgtgatggcaatccgaatgtcacccacaaggtgacccgccgggtcttcctgcttggccgc
tggatggcagcggatctctatcttcgtgatattcaggcgctgcgggccgaactgtccatg
tggcaggccagcgacgagctcaaggccgttgttggtgactcccgggaaccctaccgccat
gtgctcgccgaactccgtgagcggctgatcagaacccgggactgggcagaggcgagcgtc
aacggcgagaccgcggatgccaacggtattctctttgagaacgaggatttcaccggtccc
ctggagctctgttaccgatccctggttgagtgcggactcgaggacatcgccaatggtccg
ctgctggataccatccgccgggcgcatacttttggcctgcctttgattcgtctggacatc
cgccaggaggccagccgccacgcggaggcggttgccgaaatggtcgattatcttggcctg
ggggattatctgtcctggtcagaacaggaacgccaggcattcctggtgaaggaacttcag
ggccggcgcccactggtcccccgaaattgggagccctccgaatcggtcggcgaggtgctg
gcaacctgtgaagtggtggcgcagcaaacgccggaagccctcgggtcctatgttatctcc
atggccagcaagccctctgatgtattgagcgtgattttgctgctcagggaatccggaatg
aagtttccgatgcgggtcgtgcctctgtttgagaccctggatgacctgcgtggtgctcca
gacagcatgtctgcgctgtacgaggttgagtggtatcgggagtattgccagggcaggcag
gaagtgatgatcggttattcggattcctccaaggatgccggccagctgatggcggcctgg
gcccagtaccaggcccaagagaaacttacccatgttgcccgccagtatggcgtacatctg
accctgttccacggccggggcggtaccgttggccgtggcggcggaccagccaacagggcg
atactgtcccagccgccgggctcggtaaacggcagtttccggattaccgagcagggcgaa
atgatccgcttcaagttcggtttgccgaggctggcggttcagagcctgacgctctacacc
acggcggttatcgaagctaccctggccccgccaccccagcccgaagacagctggcgtgaa
accatggactggcttaccgagcggtccttgaaagcctaccgcgatgtggtccgggaaaat
cccgacttcgtgccctatttccgccaggtcacgccggaacaggcgctggggaaactggca
ctcggaagtcgcccggcccggaggaaggccaccggtggcgtggaaagccttcgggccatt
ccgtggatattcgcctggacccagatgcggctgatgctgcccagttggctgggcagtgac
gtggcgcttgaagaggcggcccgggaccaccggcttccggtattgcgtgagatgatgcag
ggctggccgttcttccgtacctatgtagatatgctggaaatggtgctggccaaggcagac
ctgcgcatcgccagctattatgagcagacgctgctggacgatgatcggttgaaagccctg
ggggagagtcttcgcgtgcgcctccagggttgtatcgagcgacttctggaactcaaggag
caaacggatctgctggagggagaacccgtctttgcgcattcgatgagggtgcgtaaccca
tacacggatccgctgcactaccttcaggccgaattgctacggcgggaccgggaaagtgaa
ggcaagggcgaggtgccggaactggtggaaagagcactgaaagtcaccatggcaggtatc
gctgcgggcatgcggaatactggctga

DBGET integrated database retrieval system