KEGG   Marinobacter adhaerens: HP15_853Help
Entry
HP15_853          CDS       T01922                                 

Definition
(GenBank) RIO1/ZK632.3/MJ0444 family protein
  KO
K07178  RIO kinase 1 [EC:2.7.11.1]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_853
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mad03009]
    HP15_853
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HP15_853
Protein kinases [BR:mad01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   HP15_853
Ribosome biogenesis [BR:mad03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    HP15_853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RIO1 Kdo APH YrbL-PhoP_reg Pkinase
Motif
Other DBs
NCBI-ProteinID: ADP96617
UniProt: E4PR82
LinkDB All DBs
Position
complement(870387..871283)
Genome map
AA seq 298 aa AA seqDB search
MNVAGRLTVRLKGFMKVPKRLQPLVDDGMVDEVLYQLMSGKEAQVYVVRCGDQTRCAKVF
KEASKRSFKQAVEYQEGRKVRNSRRARAMSKKTKYGQKEQEEAWLNSEVDALYRLAAAGV
RVPEPLGFVDGVLLMELVADEDGKAAPRLDDVILSPEQARDFHDQVIREVVRMLSAGLIH
GDLSEFNVLVDASGPVIIDLPQAVNASGNNNAERMLERDVDNMRRYFGRFAPELLNTDYG
KEIWALYESGDLHPDSKLTGCFQHDDTAANVDELMEIIDAAKEEEWERQERMRDAEED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggctggccgactcactgtccgtctgaaaggttttatgaaagtaccgaaaaga
ttacaaccacttgtcgatgacggcatggtggacgaagtgctctaccagctcatgagcggc
aaggaagcccaggtttatgtggtgcgttgtggcgatcagacacgatgcgccaaggtcttc
aaggaagcctccaagcgaagcttcaagcaggcggtggaataccaggaaggccgcaaggta
cggaacagccggcgcgcccgggccatgagcaaaaaaaccaaatacggccagaaggaacag
gaagaagcctggctcaactccgaggtggatgccctgtaccggcttgccgctgccggtgtc
cgggttcccgagcctctgggcttcgtggacggtgtgctgttgatggaactggtggcggac
gaagatggcaaggctgcacccaggctggatgatgtcatcctgtccccggaacaggcccgc
gacttccacgatcaggtcatccgagaggttgtccgtatgttgagtgccggtctgatccat
ggggatctgtcggaattcaatgttctggtcgatgccagcggacctgtcattattgatctt
ccccaggccgtcaatgcctccggcaataacaacgcggaacgcatgctggagcgcgacgtc
gacaatatgcgccgctatttcggacgcttcgcgccggaactgctgaacaccgattatggc
aaggagatctgggcgctctacgagtccggcgacctgcacccggacagcaagctcacgggc
tgcttccagcacgatgacaccgctgccaacgtcgacgaactgatggaaatcatcgatgcg
gcaaaagaggaagagtgggagcgacaggaacggatgagggacgccgaggaggactga

DBGET integrated database retrieval system