KEGG   Marinobacter adhaerens: HP15_895Help
Entry
HP15_895          CDS       T01922                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_895
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HP15_895
Protein kinases [BR:mad01001]
 Serine/threonine kinases: Other
  Bacterial family
   HP15_895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_14 TPR_6 APH TPR_19 TPR_20 Pkinase_fungal TPR_21 Kinase-like TPR_12 TPR_4 TPR_16
Motif
Other DBs
NCBI-ProteinID: ADP96659
UniProt: E4PEV4
LinkDB All DBs
Position
909179..910831
Genome map
AA seq 550 aa AA seqDB search
MNAILSFIPRLFSLRAVILVLAVVFALMGDQLALVGWADRALFSILGVPEGATPATILPQ
EAFGPAMADRGLSEPLWSDMAVTAGLAIAALYLVLAIPAMGAAVSLPVTLLLGGSLVVIQ
AALMFYRNAWVPFGVVLTLLVVGYVVMLFWLQPRKHIRALTDNVRDARLKLAKVFLQQGH
TDEALEALDRCPDCESEIELRYDVAIQQERKRQYDKAVSTYRSIQERKKGFRDTAARLSA
LEKLAPDNSLMQGGSFDNTRTLLMPEPAVSRPTLGRYEIEREIGRGAMGVVYLGKDPKIA
RTVAIKTLSYQAFDDGQLQDLKERFFREAEAAGRLSHPAIVTVYDVGEEADLAYIAMDYA
KGRPLSEFGRTGRLLPLPRVLDIVARVADALAYAHSQKIVHRDIKPGNIIFNPDNGDIKI
TDFGIAKISDDSRTRTGAVMGSPLYMSPEQLKGQKVTGASDIYSLGVTLYKLVSGETPYQ
GDTLANLTYQILNKRPRSVREFNADLPNGVVRLINKAIQREPDKRFASAATMAEAVRRLA
VREAGQEVSS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccatactctctttcataccgcgcctgttcagtctgcgggccgttattctcgtt
ctggctgttgtgtttgccctcatgggggaccagcttgccctcgttggctgggctgaccgt
gcgctattcagcattctcggcgtgccagagggcgcgaccccggccacgattctcccgcag
gaggcattcgggccggctatggctgatcgggggctttcggaaccactctggtccgacatg
gcggtgaccgccgggctggcaattgcggcactgtatctggtgcttgcaattccggcgatg
ggcgcggccgtttccctgccggtcactcttttgcttggtggctcgctcgtggtgatccag
gcggctttgatgttctaccgcaacgcctgggtgccgtttggcgtggtgctcacgttgctg
gtggtcggttacgtggtgatgctgttctggctgcagccccgcaaacacatccgtgcactg
acagataatgtgcgggatgcgcggctgaagctggccaaggtatttctgcaacaaggtcat
acagacgaggccctcgaagcgctggatcgctgccccgactgtgaaagcgagatcgagctg
cgctacgacgtcgccatccagcaggagcgcaagcgccagtacgacaaggcggtcagcacc
taccgcagtattcaggagcgaaagaaaggttttcgggataccgccgcgaggctgtcggca
ttggaaaagctcgcgccggataactcgttgatgcagggagggagtttcgacaatacccgc
accctgttgatgcccgagcccgccgttagtcgcccgaccctcggaaggtacgaaatcgag
cgggagattggccgaggggccatgggtgtggtttatctgggcaaggatccgaagattgcc
cgtaccgttgccatcaagactctcagctaccaggcgtttgatgatggacagcttcaggat
ctcaaggagcgattcttccgggaggcagaagccgctggccgtctgagccacccggctatc
gtcaccgtgtatgacgttggcgaggaggcagacctcgcctatatcgccatggactatgcg
aaaggacgtccgctcagtgaattcggcagaaccggacggttactgcccctgcccagggtt
ctggatatagttgcccgcgtggcggacgctctggcctacgctcacagccagaaaatcgtc
caccgcgacatcaagcccgggaatatcatcttcaatcccgacaatggcgatataaagatc
accgatttcggcattgccaagatctccgatgactcgcgaacccgcaccggcgcggtaatg
ggcagcccattgtatatgtcgccggagcagttgaagggtcagaaggtaaccggtgcctcc
gatatctacagcctgggcgtaacgctttataagctggtgagcggcgaaacaccctatcag
ggcgataccctggccaacctgacctaccagattcttaacaagcgcccacgcagcgtccgc
gagttcaacgcggatctgccaaacggggtggtccgcctgatcaacaaggctatccagcgc
gagccggacaagcgctttgccagtgccgccaccatggccgaggccgtgcgtcgtctggcc
gttcgtgaggctggccaggaggtgtcgtcctga

DBGET integrated database retrieval system