KEGG   Marinobacter adhaerens: HP15_p187g34Help
Entry
HP15_p187g34      CDS       T01922                                 

Definition
(GenBank) uncharacterized conserved protein, HipA-like protein
  KO
K07154  serine/threonine-protein kinase HipA [EC:2.7.11.1]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_p187g34
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mad02048]
    HP15_p187g34
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HP15_p187g34
Protein kinases [BR:mad01001]
 Serine/threonine kinases: Other
  Bacterial family
   HP15_p187g34
Prokaryotic defense system [BR:mad02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HipA-HipB
    HP15_p187g34
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HipA_C Couple_hipA
Motif
Other DBs
NCBI-ProteinID: ADQ00031
UniProt: E4PRZ6
LinkDB All DBs
Position
pHP-187:26119..27468
Genome map
AA seq 449 aa AA seqDB search
MSLTLQIHWDYQWHDAGVIEFRDPDQGLRGSPTFSYDMDYALKALERIEDFGHLDLIDRT
AVGVNLPCILAGDYMNGEIVPILRDIIPQGAGRRHWVKSLGYDRDPEHRIDFQLLAEGCV
GPVGNLRIKEAAEAFESQVARSEVVLFDREEVCTRADSLIQYAHSLHVAIGGATGAGGDA
PKLLLVENHYGQFALEGTIPDEEIARHWLVKFPRGRKTSDDIRVLGGEAAVYQFLEKRGF
NAITGAAFDDIHGDVALWLPRFDREVREDGILRHGMESVYSMMGVIGDGARLDHVDVIRK
LQDYVTKPEDKDAVLADYLVRDVLNTATGNRDNHGRNTSLIKRGHNIELAPAYDIAPMVL
DPESIAMSTWWPHHLLDQRRNPDYSLILEELAVNPKAAASIMESELLKLKDMKAGLKLYG
APDAMLNHIAIRMHEPELVHDQLERLLCP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagccttacccttcaaattcactgggactaccagtggcatgatgccggcgtaatcgaa
ttcagagaccctgaccaaggccttagaggcagcccgacattctcgtatgacatggactat
gctctgaaagccttagagcgcattgaagattttggccatctggacttaatcgaccggaca
gctgtgggagtgaatctgccctgcattttggccggcgactacatgaatggtgagattgtc
ccgatccttagagacatcattcctcaaggagctggtcgccggcactgggttaaaagcctt
ggatatgaccgcgatcccgagcatcgaatcgattttcagctcttggctgaggggtgtgtc
ggtccagttggcaatttgcgaatcaaagaagcggcggaagcgttcgagtcccaggttgca
agatcagaggttgttctattcgaccgagaagaagtgtgtacccgggccgacagccttatc
cagtatgctcacagcctgcatgttgcgattggtggcgcaaccggcgccggcggtgacgcg
ccgaagcttttgttggttgaaaaccattatggccagtttgcgcttgagggaaccattcct
gacgaagagatcgcccggcactggctggttaaatttccgaggggaaggaaaaccagcgat
gatattcgggtacttgggggtgaagccgctgtttaccagtttcttgaaaagcggggcttt
aacgctatcaccggggctgctttcgatgacatccacggcgatgttgctctttggttaccg
cgttttgaccgagaagttagggaagacggcatcttgcgccatgggatggagtctgtttat
tcgatgatgggcgtaattggcgatggtgctcgcctggatcacgtcgacgtgatccggaaa
ctccaggattatgtaaccaagcctgaggacaaggacgcagtgcttgcagattacctggtt
cgggatgttttgaacaccgcaacgggtaatcgcgacaaccacggtcgaaatacatcattg
attaagcggggccataatattgagttggcgccggcttatgacatagcccctatggtgttg
gaccctgaatcaattgcgatgtctacatggtggccacatcacctgctggatcaacggcga
aatccagattattcgctgattctggaggagcttgctgttaatccaaaggcagctgcaagc
atcatggagagtgagctgctgaagttgaaggatatgaaggcaggcttgaagctgtatgga
gctccggatgcaatgctgaatcatattgcgatccggatgcatgagccggaattggttcat
gatcagctggaacgattgttgtgtccgtag

DBGET integrated database retrieval system