KEGG   Marinobacter adhaerens: HP15_p187g46Help
Entry
HP15_p187g46      CDS       T01922                                 

Definition
(GenBank) exopolysaccharide tyrosine-protein kinase
  KO
K16692  tyrosine-protein kinase Etk/Wzc [EC:2.7.10.-]
Organism
mad  Marinobacter adhaerens
Pathway
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_p187g46
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mad01001]
    HP15_p187g46
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.-  
     HP15_p187g46
Protein kinases [BR:mad01001]
 Non-receptor tyrosine kinases
  Bacterial
   HP15_p187g46
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GNVR Wzz AAA_31 CbiA ParA AAA_26 MipZ ArsA_ATPase Fer4_NifH APS_kinase IstB_IS21 Occludin_ELL
Motif
Other DBs
NCBI-ProteinID: ADQ00043
UniProt: E4PS08
LinkDB All DBs
Position
pHP-187:38818..41028
Genome map
AA seq 736 aa AA seqDB search
MTDVTAVKSSRKAQPDDEIDIGFLLGSLWDHKGFIVALTLMLGVAGFVYASLSTPIYQGD
ALVQVEKKSGTIPGADMSQMLGRQGPDTNTEIEILRSRLILGQVVDQTDLQVVVEPVYLP
WVGEWLYRKGVSRPGVFEGKPYVWGGESLSIGSLVANHHSDTVRFFVESLGDGRYRVLDL
QEKLLGEGQVGEQLVIELPYFELRVADLSAPKGARFEVTKLSRLSATNQLKNRLTIQSQG
RETGILRLVMQGADQQEIVNSLDATTQVFLTQNIARQAAEAKKSLEFLEEQAPKVRQQLT
EAENRLNEYRLKSDSIDLSFETQNALTSLVQIEASLNELALQESELARRFTPNHPVYRSL
LEKKEQLLREKSRLEERTDDLPETQQQVLRLSRDVQVTQEIYVQLLNRMQELRLARAGTI
GNVRILDNAVVQGQVAPRKNLIVAVSALSGLLLAMVTVLLRAAFNRGIVSPEQLEEMDLS
VYATVPLSDEEKRSTEGGKKRTFKRRKAKKRDLLAARNPADLSIEAIRSLRTSLHFAMLE
AADNRLMITGPSPGIGKSFISANLATVCAQSGQRVVVLDGDMRKGHVHEAFGGSTSNGLS
DVLSGQLSFDDSIHDSSVDGLSWVGRGSAPPNPSELLMHKRFSEYLKYLSERFDLVVIDT
PPILAVTDAAVIGAQCGTSLMVVRFGQNTPKEVQIAESRLSTGGVALKGAILNAMEKKAA
TSYGYYGYYNYAYKSD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtaacggcagtaaaatctagcagaaaagcacaaccggatgatgagatagac
atcggtttcctgcttggaagcctctgggaccacaaaggttttattgtggcactgactctc
atgctcggggtggccgggttcgtatacgcgtcattatctacgcctatctatcagggggac
gcgctggtccaggtagagaagaaatctggcacgattcccggggctgacatgtcacaaatg
ttgggtaggcaagggcctgacaccaacacggaaattgagattcttcgttcacggctgatt
ctcgggcaggtcgtcgatcagaccgaccttcaggttgtggttgagccggtatatttacct
tgggttggcgagtggctctatcgaaagggtgtgtcgcggcctggggtgtttgagggcaag
ccttatgtgtggggcggtgagtccctctcgattggctcgttggttgccaatcatcacagt
gacacagttcgcttttttgtcgaatcgctgggcgatggccgttatcgcgttctggatctt
caagagaagctactcggagagggacaggttggtgagcagcttgttattgaactgccctat
tttgagttgcgcgtcgccgatctgtccgctccgaaaggagcgcggtttgaggtgacaaag
ctgagtcgcctctcagccaccaatcagctaaaaaatcgacttaccattcaatcccagggc
cgtgaaaccggaatcttgcgcctggtgatgcaaggcgctgatcagcaggaaatcgtaaac
agtttggatgcgaccacccaggtatttttgacccagaacattgcacggcaagcggccgag
gctaagaagagcctggagttcttggaggagcaggcgccaaaagttcgccaacagctcacc
gaagcggaaaatcggctcaacgagtaccgtctaaaaagcgatagtattgatctaagcttt
gagacccagaatgcgctcactagtctggttcagatcgaggcaagcctgaacgagctggca
ctgcaggaatcggagctggctcggcgttttaccccgaaccacccggtttatcgctcgttg
cttgagaaaaaagagcagctgcttcgcgagaagagccggttggaggagcgcaccgacgat
ttgccagaaacccagcagcaggttttgcggctgagccgggatgtgcaagttacgcaagaa
atttatgtacagctattgaacagaatgcaggagctccggcttgccagagccggcacaatc
ggcaacgttcgcatcctggataacgcggtggttcaggggcaagttgccccgcgtaaaaat
ctgatcgtggccgtatctgcgctgtcgggattgctgcttgcgatggttactgtgttgctt
cgtgctgcgttcaatcgagggattgtctcgccggagcaacttgaagagatggacctgtcg
gtctatgcaacggtgcctctatcggatgaagaaaaacgatcgactgagggcggcaaaaaa
cggactttcaagcgtcgtaaagctaaaaagagagatttgttggctgcccgaaacccggcg
gatctctccatcgaggcgattcgcagtctgcgcacatccttgcacttcgccatgctcgaa
gccgctgataaccggttgatgatcacagggcccagcccgggcattggtaaaagctttatc
tcggcaaacctggcaaccgtctgtgcgcaatctggccaacgagttgttgttctagacggc
gatatgcgtaaagggcatgtgcatgaggcgttcggtggctccacgagcaacggtctttcc
gatgtattgtctgggcagttgtcatttgacgacagtatccatgactcaagcgtcgacgga
ttaagctgggtgggtcggggcagtgcaccaccaaacccttcagagcttttgatgcataaa
cgattcagcgaatacctcaagtatctgtctgagcggtttgatcttgtcgtcattgatacg
ccgccgatcctcgcggtgaccgatgccgccgtcattggcgcgcaatgcggcacaagtctc
atggtggtgcgttttggtcagaatacgccgaaggaagtgcaaatcgcggagagccggctt
tctacggggggcgtggcgctcaaaggcgccatcttgaatgcgatggagaagaaagcggcc
accagctatggctattacggctactacaactacgcgtacaagtcggactaa

DBGET integrated database retrieval system