KEGG   Mariprofundus aestuarium: Ga0123461_0433Help
Entry
Ga0123461_0433    CDS       T05212                                 

Definition
(GenBank) DNA polymerase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
maes  Mariprofundus aestuarium
Pathway
maes03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:maes00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Ga0123461_0433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:maes03400]
    Ga0123461_0433
Enzymes [BR:maes01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Ga0123461_0433
DNA repair and recombination proteins [BR:maes03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Ga0123461_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ATX78872
UniProt: A0A2K8KW56
LinkDB All DBs
Position
414525..415235
Genome map
AA seq 236 aa AA seqDB search
MQTPVSLFASGPAISAPEVAVEEKTALPATEVHAPAVDSSVIEISSVEVSTSGGLSSLEA
KAATCRLCSLAETRTQVVFGTGNPSADIVFIGEAPGRDEDLKGEPFVGRAGQLLDRMLSA
IGMDRNQVYIMNTIKCRPPNNRDPKIDEVQACNLWFEQQLALLQPKVICLLGRVAAQTVL
ETDAPLGSLRGHWHNYQGMPVWVTYHPAYLLRSPTQKQKSWQDLQQLVSRYREIKG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacaccggtttccctttttgcatccgggccggcgatttcggcaccggaggtggct
gttgaagaaaagacggctctaccagcgactgaggttcacgcgcctgctgtagattcttca
gttatagaaatatcttcggttgaggtttctacatccggaggcttatcttctttggaggca
aaggcggctacgtgtcgtctttgttcgctggctgaaacgcgtacgcaggtggtgtttggg
acaggcaatccgagtgctgatattgtctttattggtgaggcgccagggcgtgatgaggat
ctgaagggcgagccatttgtcggtcgtgcgggtcagttgcttgatcgcatgctctcggca
atcgggatggaccggaatcaggtctatattatgaatacaatcaaatgcaggccgccgaac
aatcgcgatccaaagattgatgaggtgcaggcctgtaatctctggtttgaacagcagctt
gcgttgctgcagccaaaggtgatttgcctgctggggcgtgtggctgcgcagaccgtgctg
gaaaccgatgcgcctctgggttcattgcgcgggcactggcacaactatcaggggatgccg
gtctgggtgacctatcatcctgcttacctgttgcgttcgccgacgcagaaacagaagagc
tggcaggacctgcagcagcttgtttcgcgctatcgggaaataaaaggctga

DBGET integrated database retrieval system