KEGG   Mariprofundus aestuarium: Ga0123461_1840Help
Entry
Ga0123461_1840    CDS       T05212                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
maes  Mariprofundus aestuarium
Brite
KEGG Orthology (KO) [BR:maes00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:maes01001]
    Ga0123461_1840
Enzymes [BR:maes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Ga0123461_1840
Protein kinases [BR:maes01001]
 Serine/threonine kinases: Other
  Bacterial family
   Ga0123461_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr CHASE2 Pkinase_fungal APH TPR_2 Kdo TPR_1 Kinase-like TPR_14 TPR_7
Motif
Other DBs
NCBI-ProteinID: ATX80252
UniProt: A0A2K8KZM9
LinkDB All DBs
Position
1872109..1874520
Genome map
AA seq 803 aa AA seqDB search
MNHDAIWKSGGLIGIIVSLLFLTGYSSHLSTFRTADNLLYDFISQKNTLPTDSRIILVEV
DASSSEQKSHAAIAAAINKLSNAGAKLIALDILYTEPELQPEDNNSGEAQKDMLAENIRL
AGNVLLPLYFEFGSEVIQSNILSPSQIRRSTFRQINRNATAAVSAFMLHYPYSNLLEGAA
GFGHFNLFPDPDGTVRSHPLAIELSDKFYPSIALVLAAGAMNIPTSDMRLNIGTDIELGA
LNVATDRDIRIYPAFHTDGSGGSYSRFSLSELLSESTPADLFKDKIILIGSTADNSSNSF
ITPLKRNMSRIEFVAHSIQSILKEESVIRPGWTLYIELALLLLAGLYLTLLLPRLSGIAG
VAATVTATLVLLITGFFLISAFSIWIQTCLTALLLIIGHLCIGIRAHFIAKEQQPSSTSD
SNETNKMLGLSFQSQGMLENAYKKFLICPLDEEMLPILYDLGLAFERKRQFDEAINVYQH
MATYNSNFRDIQVRLINAKRSKEAVSEKGSNDGVANLLAGGDINPTLGRYEIFSELGKGA
MGTVYLGKDPQINRQVAIKTLALSKEFEADQLEEVKKRFFHEAEIAGMLNHPNIVTIFDA
GAEHDLAYIAMEYLDGIDLIRYTQKGKTLPIPTTLKIVAKVAEALQYAHDHGVIHRDIKP
ANIMILKNKSVKVTDFGIAHINDSSKTKAGIVMGTPSYMSPEQLSGKKVDGRSDLFSLGV
MLYEMVAGVRPFTADSISKLMLKVARVPHTDVRELDPEVPDSVAELINSMLAKNPENRIA
SAHEVLDRIHQCLQENRAQEGTP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcatgatgctatctggaaatcgggcgggcttattggcatcattgtttcgctgcta
ttcctgactggatacagcagccatctctctaccttccgaactgctgacaacctgctttat
gacttcatctcccagaaaaacactcttcctacggacagcagaatcattcttgttgaagta
gacgccagcagcagtgagcaaaagtcacatgcagccattgcagcagccattaacaaacta
tccaatgcaggtgccaaacttatcgcactggatatcctctacaccgaacctgagctacag
ccggaagacaacaacagtggtgaagcacagaaggatatgctggcagagaatatccgcctt
gctggcaacgtcctgcttccgctctattttgaatttggttcagaggtcatacagagtaac
atcctttcgccaagtcagattaggcgttcgacattcagacagatcaaccgcaatgctaca
gcagctgtcagcgcttttatgctccattacccttacagcaacctattagagggcgctgcc
ggcttcgggcacttcaacctgtttcctgatccggatggcactgtccgctcacaccccctg
gccattgaactctcggataagttttatccatctatcgcactagtactggcggcaggggcg
atgaacattccaacaagtgacatgcggctgaatattggcaccgatattgaactgggtgcc
ctgaatgtcgccaccgatcgtgatatccgcatttacccggcctttcataccgatggcagc
ggcggaagttacagtcgattcagcctctccgagcttctttcagagagcacacccgctgac
ctgtttaaggacaagatcatcttgattggcagcaccgccgacaacagctcaaacagcttc
ataacaccattaaagcggaatatgtcgcgcatcgagtttgttgcccacagcattcaaagc
atccttaaagaggagtcagtcattcggccgggctggactctctacattgagcttgcgctg
ctactgcttgcggggctctacctgacccttcttctaccacgtctttctggtatcgcaggg
gttgctgcaacagtgactgccactctcgtactgcttatcacaggcttctttttgatatcc
gcattttctatctggattcaaacctgcctgacggctctactgctgattattggccaccta
tgcatcggcatcagagcacattttattgccaaagaacaacagccctcctcaacaagtgac
tcgaatgaaaccaataaaatgcttgggctctcgttccagagccagggcatgctggaaaat
gcatataaaaaattcctcatatgcccgctagatgaggagatgcttcccatcctgtatgac
ctggggcttgcctttgaacgcaagcgccagtttgacgaagcaatcaatgtctatcagcac
atggccacctacaacagcaacttccgcgacattcaagttcgacttatcaatgcaaaaaga
agcaaggaggctgtttcagagaagggttcaaacgatggggtggccaacctgctggcaggt
ggcgacatcaacccgaccttgggccgctacgagatattcagcgaattgggtaagggtgcc
atggggactgtataccttggcaaggacccacaaatcaaccgtcaggttgccattaaaaca
ctggctctctccaaagagtttgaggccgatcagcttgaagaggtaaaaaaacgattcttc
catgaggccgaaattgccggcatgctcaaccatcccaacattgttaccattttcgatgcc
ggtgcggaacacgaccttgcctatattgccatggagtacctggatggaatcgacctcatc
cgttacacccaaaagggcaaaaccctgccgatcccgaccacactgaaaatcgttgccaag
gtagctgaagcacttcagtacgctcacgaccacggtgtcatccatagagacattaagccg
gccaacatcatgatcctgaaaaacaagagcgtaaaagtaaccgacttcggcatcgcccac
attaatgactcgagtaaaaccaaagctgggattgtcatgggcaccccctcctatatgtca
ccggaacagctttcaggcaaaaaggttgatggccgctccgaccttttctcccttggcgta
atgctctatgagatggttgccggcgttcgcccattcactgccgattcaatatcaaaactg
atgttaaaggttgccagggtaccgcatacggatgtgcgcgaacttgatcctgaagttcca
gacagtgtggctgagttgattaatagcatgctcgccaagaatcctgaaaatcgcatcgcc
tctgcccatgaagtgctggatcgcatccaccagtgccttcaggaaaacagagcgcaggaa
ggcactccgtga

DBGET integrated database retrieval system