KEGG   Mycobacterium africanum: MAF_09470Help
Entry
MAF_09470         CDS       T01575                                 

Definition
(GenBank) putative ATP dependent DNA ligase (ATP dependent polydeoxyribonucleotide synthase)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
maf  Mycobacterium africanum
Pathway
maf03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:maf00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MAF_09470
Enzymes [BR:maf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAF_09470
DNA repair and recombination proteins [BR:maf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MAF_09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CCC26019
UniProt: F8M4I3
LinkDB All DBs
Position
1042493..1044772
Genome map
AA seq 759 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAE
PGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLY
TPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAP
YSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPDN
TSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVNL
HGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFEG
KWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGVP
SFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGRSSGV
GSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITYV
KPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggaggtgcacgtgccgcagtggcggtttgtcgccgag
cccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggacccg
ggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatcttctc
gccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctgtac
acaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtcgcg
cagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctgcgg
gccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcgccg
tactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggagctc
gacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgcgac
ggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccgatac
cgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgttacc
ggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgatttc
cggctggaacgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgacaac
acatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacgttc
gagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactccggc
acttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaatctg
cacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtggctg
gcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcccca
atgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaaggc
aagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcggtcc
cgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggatctc
gccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtgccc
agcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttcgac
ctgctctacctcgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaagctg
ctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgacggc
gcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagaggcgt
gactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactggaac
acccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcgcagcagtggcgtc
gggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtcggt
accggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcatacc
gacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatatgtc
aagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctgcgt
caatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system