KEGG   Mycobacterium tuberculosis variant africanum: MAF_33330Help
Entry
MAF_33330         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium tuberculosis variant africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 DUF4129
Motif
Other DBs
NCBI-ProteinID: CCC28403
LinkDB All DBs
Position
complement(3688615..3688857)
Genome map
AA seq 80 aa AA seqDB search
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLP
HRGGAVSNALIDRLRDEEAV
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccacgttgtccatcgacgacgatgtattgctggccgtgaaggaacgggcacgc
agggagaagcgcaccgcgggtgaaatcctgtcggatctggcccggcaagcgttaaccaac
cagaatccccagcctgcggcgagccaggaggacgcctttcatggcttcgaacccctgcct
catcgcggtggagcggtatcgaacgcgctgatcgatcggcttcgtgacgaggaggccgtg
tga

DBGET integrated database retrieval system