KEGG   Mycobacterium tuberculosis variant africanum: MAF_38400Help
Entry
MAF_38400         CDS       T01575                                 

Gene name
pks2
Definition
(GenBank) putative polyketide synthase PKS2
  KO
K12431  phthioceranic/hydroxyphthioceranic acid synthase [EC:2.3.1.287]
Organism
maf  Mycobacterium tuberculosis variant africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maf01004]
    MAF_38400 (pks2)
Enzymes [BR:maf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.287  phthioceranic/hydroxyphthioceranic acid synthase
     MAF_38400 (pks2)
Lipid biosynthesis proteins [BR:maf01004]
 Polyketide synthase
  Modular PKS
   MAF_38400 (pks2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR PS-DH Ketoacyl-synt_C ADH_zinc_N ADH_zinc_N_2 KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CCC28909
LinkDB All DBs
Position
complement(4270766..4277146)
Genome map
AA seq 2126 aa AA seqDB search
MGLGSAASGTGADRGAWTLAEPRVTPVAVIGMACRLPGGIDSPELLWKALLRGDDLITEV
PPDRWDCDEFYDPQPGVPGRTVCKWGGFLDNPADFDCEFFGIGEREAIAIDPQQRLLLET
SWEAMEHAGLTQQTLAGSATGVFAGVTHGDYTMVAADAKQLEEPYGYLGNSFSMASGRVA
YAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLEPRKAAAGSALGM
LSPTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGHTVNIA
TPSQPAQVAAYRAALAAGGVDAATVGMVEAHGPGTPIGDPIEYASVSEVYGVDGPCALAS
VKTNFGHTQSTAGVLGLIKVVLALKHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPT
NGRQVPRRAAVSSYGFSGTNVHAVVEQAPQTEAQPHAASTPPTGTPALFTLSASSADALR
QTAQRLTDWIQQHADSLVLSDLAYTLARRRTHRSVRTAVIASSVDELIAGLGEVADGDTV
YQPAVGQDDRGPVWLFSGQGSQWAAMGADLLTNESVFAATVAELEPLIAAESGFSVTEAM
TAPETVTGIDRVQPTIFAMQVALAATMAAYGVRPGAVIGHSMGESAAAVVAGVLSAEDGV
RVICRRSKLMATIAGSAAMASVELPALAVQSELTALGIDDVVVAVVTAPQSTVIAGGTES
VRKLVDIWERRDVLARAVAVDVASHSPQVDPILDELIAALADLNPKAPEIPYYSATLFDP
REAPACDARYWADNLRHTVRFSAAVRSALDDGYRVFAELSPHPLLTHAVDQIAGSVGMPV
AALAGMRREQPLPLGLRRLLTDLHNAGAAVDFSVLCPQGRLVDAPLPAWSHRFLFYDREG
VDNRSPGGSTVAVHPLLGAHVRLPEEPERHAWQADVGTATLPWLGDHRIHNVAALPGAAY
CEMALSAARAVLGEQSEVRDMRFEAMLLLDDQTPVSTVATVTSPGVVDFAVEALQEGVGH
HLRRASAVLQQVSGECEPPAYDMASLLEAHPCRVDGEDLRRQFDKHGVQYGPAFTGLAVA
YVAEDATATMLAEVALPGSIRSQQGLYAIHPALLDACFQSVGAHPDSQSVGSGLLVPLGV
RRVRAYAPVRTARYCYTRVTKVELVGVEADIDVLDAHGTVLLAVCGLRIGTGVSERDKHN
RVLNERLLTIEWHQRELPEMDPSGAGKWLLISDCAASDVTATRLADAFREHSAACTTMRW
PLHDDQLAAADQLRDQVGSDEFSGVVVLTGSNTGTPHQGSADRGAEYVRRLVGIARELSD
LPGAVPRMYVVTRGAQRVLADDCVNLEQGGLRGLLRTIGAEHPHLRATQIDVDEQTGVEQ
LARQLLATSEEDETAWRDNEWYVARLCPTPLRPQERRTIVADHQQSGMRLQIRTPGDMQT
IELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFAGVVTAVGP
GVTDHKVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDAQAAAVTTAHATAWYGLHEL
ARIRAGDTVLIHSGTGGVGQAAIAIARAAGAEIFATAGTPQRRELLRNMGIEHVYDSRSI
EFAEQIRRDTNGRGVDVVLNSVTGAAQLAGLKLLAFRGRFVEIGKRDIYGDTKLGLFPFR
RNLSFYAVDLGLLSATHPEELRDLLGTVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNA
EHTGKLVLHIPQTGKSLVTLPPEQAQVFRPDGSYIITGGLGGLGLFLAEKMAAAGCGRIV
LNSRTQPTQKMRETIEAIAAMGSEVVVECGDIAQPGTAERLVATAVATGLPVRGVLHAAA
VVEDATLANITDELLARDWAPKVHGAWELHEATSGQPLDWFCLFSSAAALTGSPGQSAYS
AANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSASPARASALEESNYTAITPDEG
AYAFEALLRHNRVYTGYAPVIGAPWLVAFAERSRFFEVFSSSNGSGTSKFRVELNELPRD
EWPARLRQLVAEQVSLILRRTVDPDRPLPEYGLDSLGALELRTRIETETGIRLAPKNVSA
TVRGLADHLYEQLAPDDAPAAALSSQ
NT seq 6381 nt NT seq  +upstreamnt  +downstreamnt
ttgggcttggggtcggcggcgtcaggcactggtgcagataggggtgcatggacgttggct
gaaccacgtgtgactccggttgctgttatcggcatggcttgccggctgcccggcgggatc
gattcccccgagttgttgtggaaggcgttgttacgaggcgacgacctgatcaccgaggtg
ccgccggaccggtgggattgcgacgagttctacgacccgcagccgggcgtgcccggtcgg
acggtgtgcaagtggggcggtttcctggataaccccgcggatttcgattgcgagttcttt
ggcatcggcgagcgggaggcgattgcgatcgatccgcagcaacgtctgttgctggagacg
tcctgggaggccatggagcacgccggtcttactcagcaaacgctggcaggctcggcgacc
ggcgtgttcgcgggtgtcacccatggtgactacacgatggtggcggccgacgccaaacaa
ttggaggagccgtacggatatctgggcaacagcttcagcatggcgtcgggccgggtcgcc
tacgcgatgcgactgcacggtccggcaataaccgttgataccgcatgctcgtccggcctg
acggccgtgcacatggcgtgtcgcagcctgcacgagggtgaaagcgacgttgccttggcg
gggggtgtcgccttgatgctggagccacgcaaggccgctgctggatccgctttgggcatg
ttgtccccgaccggacgttgtcgcgcgttcgatgtcgcggctgacgggttcgtgtcaggc
gagggttgtgccgtggtggtgctcaagcggttgccggatgcattggccgacggtgaccgg
atcctggcggtaattcgtggcacgtccgcaaatcaggatggccacacggtcaatatcgcg
acgccttcgcagcccgcacaggttgcggcttatcgagcggcgttggctgccggtggcgtg
gacgccgcgacggtcggcatggtcgaagcgcacggccccggcaccccgatcggtgacccc
attgaatatgcaagtgtctccgaggtgtatggggtcgacggcccgtgcgcactcgcatcg
gtgaagaccaacttcggacacacccagtcgaccgccggggtgctagggctaatcaaggtg
gttctcgctctgaaacatggtgtggttccacgtaatctgcacttcactcggctgcccgat
gagattgctggcatcaccaccaacctcttcgtgcccgaggtgaccacaccgtggcccacc
aacggtcgtcaggtgccccggcgggcggcagtgtcgtcttatgggttctcgggaacgaac
gtgcacgctgttgtggagcaagctccgcaaaccgaagcccagccccacgcggcgagcacc
cccccgaccggcacccctgccttgttcacgctgtccgcttcctcggccgacgcgctgcgg
cagactgctcagcggttgaccgactggatacagcagcacgccgactccctggtgctctcg
gatcttgcgtacacgctggcgcggcggcgtacgcaccggtcggtgcgcacggcggtcatc
gcgagcagcgtcgacgagctgattgccggcttgggcgaggtcgccgacggtgacaccgtt
taccagcccgcggtggggcaggatgaccgcgggccggtctggttattctccgggcaaggg
tcgcagtgggcagcgatgggcgccgatctgctgacgaacgaatcggtgttcgccgcgacc
gttgcggagctagagccattgatcgccgcggagtccgggttctcggtcaccgaggcgatg
acggcgcccgagaccgtgactggcatcgacagagttcagccgaccatcttcgcgatgcag
gtcgcgttggcagccacgatggcggcatacggagtgcgcccgggcgccgtgatcggccac
tcaatgggtgagtcggccgcggctgtggtcgcaggagtgctgtcagccgaagatggggta
cgcgtcatctgccgacgatcaaaactgatggcgacgatcgccggttccgcggcgatggcg
tcggtggagttgcctgccttagctgtgcagtcggaattgaccgctctaggcatcgacgat
gtggtggtcgccgtggtgaccgcgccgcagtccaccgtgatcgccggaggcaccgagtcg
gtgcgcaagctggtcgacatatgggagcggcgagacgtgctggcgcgggcggtggccgtc
gacgtggcttcgcattcgccgcaggtggatccgatcctcgacgagttgatagctgcgctg
gccgacctgaatccgaaagctcctgagattccctactattcggcgacgcttttcgacccg
cgcgaagcgccggcgtgcgacgcgcgttactgggccgacaatttgcgccacaccgtgcgg
ttctccgctgcggtgcgctcggcgctcgacgacgggtaccgagtcttcgccgagctttcg
ccgcacccgctgctgacccacgcggtcgatcagattgccggcagtgtaggcatgccggtt
gccgcgctggccggtatgcggcgggagcagccattgccgctggggctccgtcgcctgctg
acggatctgcacaacgctggtgcggcagtggacttctcggtgctctgtccccaaggccgc
ttggtcgatgctccgctgccggcgtggtcgcaccggttcctgttctatgaccgcgaaggc
gttgacaatcggtcgccgggtggctccacggtagccgtgcacccgttgttgggcgcacac
gtgcgattgcccgaagagccggaacgccacgcctggcaggccgatgttggtaccgcaacc
ttgccctggttgggcgatcaccggatacacaacgtggctgctcttccaggggccgcctac
tgcgagatggcgttgtctgcggcccgtgccgtcctcggcgagcagtccgaagtacgcgac
atgcgctttgaggcgatgctgctgctggatgaccagaccccggtgtccaccgtggcaacg
gtgacctcgcccggtgtcgtcgacttcgccgtcgaggccttgcaggaaggcgttgggcat
cacttgcggcgtgcgtcggcggtgctgcagcaggtatccggcgaatgcgagccgccggcg
tacgacatggcctccttattggaagcccacccttgccgcgtggacggtgaggatctgcgc
cggcaattcgacaagcacggtgtgcaatatggtccggccttcaccggcctggccgtggcc
tatgtcgcggaggatgcgaccgccacaatgctggccgaagtcgcgctgcccggctcgatt
cgttcgcagcagggcctgtacgcaatccacccggccctcctggatgcctgtttccagtcg
gtcggcgcgcatcccgatagccagtcggtaggtagcggcctattggtgccgttgggggtg
cgccgagtccgtgcctatgctccggtgcgtaccgctcgctattgctacacgcgggtgacc
aaagtcgagttggtcggcgtcgaggccgatatcgacgtgctggacgcgcacggcacggtg
ttgctggccgtgtgcggactgcgaatcggtacgggagtgtccgagcgcgataaacacaat
cgggtgctgaatgagcgcttactcaccatcgaatggcaccagcgtgagctgcccgagatg
gacccctctggcgctggaaaatggctgctgatcagtgactgcgctgcctctgatgtgacc
gctacccggctagcggacgcgtttagggaacacagcgcggcgtgcacgacgatgcggtgg
ccactgcacgacgaccagttggccgccgccgaccagctacgcgatcaagttggtagcgac
gagtttagcggcgtggtcgtgctcaccgggtcgaacaccggtacgccgcatcaggggagc
gcggatcgcggcgctgagtacgttcgccggctggtgggtatcgctcgcgaattgtcagac
cttcccggggcggtgccgcgcatgtacgtcgtgacgcggggtgcccagcgggtgctggcc
gacgactgcgtcaatcttgagcagggcgggctgcgtggtctactgcggacgatcggcgcc
gagcaccctcacctgcgtgccacccagatcgacgtggacgaacagaccggtgtcgagcag
ctggcacgccaattgctggccacgtcggaagaagacgagaccgcctggcgagacaacgag
tggtacgtggcgcgcttgtgtccgaccccgttgcgtcctcaggagcggcgcaccatcgtc
gcggatcatcagcagagcggcatgcgcctgcagatccgtacccccggcgatatgcaaacg
atagagctggccgcgtttcaccgcgttccaccaggaccaggacagatcgaggttgcggtc
cgtgcgtccagcgtcaactttgccgatgtactcatcgctttcggtcgctaccccagcttc
gagggacacctgccccagctgggcacggatttcgccggcgtggtgaccgcggtcggacca
ggcgtcactgaccacaaggttggtgaccatgttggtggcatgtcgcctaacggctgctgg
ggcacattcgtcacgtgtgacgctcggctggccgcgacgctgccaccgggcctgggtgac
gcacaggccgctgcggtgaccaccgcgcacgccaccgcctggtacggactgcatgagctc
gcccggattagggcgggtgacacggtgctaattcactccggcaccggcggggtcggacaa
gcggcgatcgctatagcccgcgcggcgggcgctgagatcttcgccaccgccggtacccca
cagcgtcgagagctattgcgcaacatgggtattgagcatgtctatgactcgcgcagcatc
gagttcgccgagcagattcggcgggacactaacggccggggtgtcgatgtcgtgctcaac
tcggtgaccggcgccgcgcaacttgccgggctgaaactgctcgccttccggggacggttc
gtcgagattggcaagcgcgacatctatggtgacaccaagctggggctctttcccttccgg
cgcaacctgtccttctacgccgtagacctggggttgctgtctgcgacacacccagaagag
ctgcgcgacctgctcggcacggtctatcgcttgaccgcagccggcgagttgccgatgccg
cagagcacccattaccccctcgtcgaggcggccaccgccatccgtgtgatgggcaacgcc
gagcacaccggcaaactcgtcctccacatcccacagaccggaaaaagcctcgttaccctg
cctcccgaacaagctcaggtgttccgtcccgacggctcctacatcatcaccggcggcctc
ggtgggctagggctgttcctggccgagaagatggccgcggccggttgcggccggatcgtg
ctgaattcccgcacccagccgacgcaaaagatgagggaaacgatcgaggccatcgcggcg
atgggctctgaagtcgtggtggaatgcggtgacatcgcccaaccgggtaccgcggagcgg
ttggtggcgaccgctgtggccaccgggcttccggtacgaggcgtgctacacgcggccgcg
gtggtcgaggacgccaccttggccaatatcaccgacgagttgctggcgcgcgactgggcg
ccaaaggttcacggtgcctgggagttgcatgaagcaaccagcggacagccgcttgactgg
ttctgcttgttttcgtcggcggcagctctcaccggctcgccgggacagagtgcctactca
gcggccaacagctggctggacgccttcgcgcattggcggcaagctcagggcctgccggct
accgcgatcgcgtggggagcctggtcggatatcggccagttggggtggtggtcggcatcg
cccgcgcgggcttcggcattggaggaaagcaactacacggcgatcactcccgacgaaggt
gcttacgcgttcgaggcgctattgcgccacaaccgcgtctataccggctatgccccggtc
atcggagccccgtggctggtcgccttcgcagagcgcagccggtttttcgaagtgttctcc
agcagcaacggttcgggcacaagcaaattccgcgtcgagctgaacgagctgccacgcgac
gagtggccggcgcggcttcggcagctggtcgccgagcaggtcagcctgattctgcggcgc
accgtcgaccctgaccgcccgctacccgagtatggacttgattcgttgggcgcactagag
ctgcgcactcggatcgagaccgagaccggaatccggttggcacccaagaacgtcagcgcc
acggtgcggggcttagcggatcacttgtatgaacagctggcgcccgacgacgctcctgct
gccgcgctgtcgtcacagtaa

DBGET integrated database retrieval system