KEGG   Magnetospirillum magneticum: amb1584Help
Entry
amb1584           CDS       T00305                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00970  Aminoacyl-tRNA biosynthesis
mag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mag00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    amb1584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mag03029]
    amb1584
Enzymes [BR:mag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     amb1584
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     amb1584
Mitochondrial biogenesis [BR:mag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    amb1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAE50388
UniProt: Q2W6Y7
LinkDB All DBs
Position
complement(1713376..1714833)
Genome map
AA seq 485 aa AA seqDB search
MAYIIQGETGDWEIVIGLEVHAQVISKAKLFSGAATEFGAEPNTQVSFIDAGFPGMLPVI
NEVCVEQAVRTGLGLKAKINLTSVFARKNYFYADLPQGYQISQYDQPIVGEGELILDLPD
GGTRTVGIERLHLEQDAGKSIHDMHPSKSFIDLNRSGVALMEIVSKPDLRSPEEAGLYLT
KLRSILRYLETCDGNMQEGSMRCDANVSVRPVGSTELRTRCEIKNVNSIRFVQQAIEFEA
RRHIDVYESGGEIRQETRLFDSVKGETRSMRSKEHAHDYRYFPDPDLLPLVIEQSFVDGI
KSGLPELPDEKKARFMAEYGLNAYDAGVLVAEKASAEFFETVAKGRDSKMACNWVMGDFF
ASLNATGKTIENPPVTAANLGQLIDLIKDGTLSGRLAKDVFALMVETGKAPAVLVEERGL
KQVTDTGAIEAAVDAVISANPDKVQQVKDGKTALLGWFTGQVMKSTQGKANPAMVNEMLS
KKILG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacatcattcagggcgaaaccggcgattgggagatcgtcatcggtctcgaggtt
catgcccaggtcatctccaaggccaagctgttcagtggcgccgccaccgaattcggcgcc
gagcccaacacccaggtgagcttcatcgacgccggcttccccggcatgctgccggtgatc
aacgaagtctgcgtcgagcaggcggtgcgcaccggtctgggcctcaaggccaagatcaac
ctgacctcggtcttcgcccgcaagaactacttctacgccgacctgccccagggctatcag
atcagccagtacgaccagcccatcgtgggcgaaggcgagttgatcctcgacctgcccgac
ggcggcacccgcaccgtgggcatcgagcgcctgcacctggagcaggacgccggcaagtcc
atccacgacatgcacccgtccaagtcgttcatcgacctcaaccgttcgggcgtggcgctg
atggagatcgtctccaagcccgacctgcgctcgccggaagaggcgggcctgtacctcacc
aagctgcgctccatcctgcgttatctcgagacctgcgacggcaacatgcaggaaggcagc
atgcgctgcgatgccaacgtctcggtgcggcccgtgggctcgaccgagctgcgcacccgc
tgcgagatcaagaacgtcaactccatccgcttcgtgcagcaggccatcgaattcgaagcc
cggcgccacatcgacgtctacgagagcggcggcgagatccgccaggaaacccgcctgttc
gattcggtcaagggcgagacgcggtccatgcgctccaaggagcatgcccacgactatcgc
tacttccccgaccccgacctgctgcccctggtgatcgagcagtccttcgtggacggcatc
aagtccggcctgcccgaactgcccgacgagaagaaggcccgcttcatggcggaatacggc
ctcaacgcctatgacgccggcgtgctggtggcggaaaaggcctcggccgagttcttcgag
accgtggccaagggccgcgattccaagatggcctgcaattgggtgatgggcgacttcttc
gcgtcgctgaacgccacgggcaagaccatcgagaacccgccggtcaccgccgccaatctc
ggccaactcatcgacctgatcaaggacggcacgctgtcgggccgcctcgccaaggacgtc
ttcgccctgatggtcgagaccggcaaggcccccgccgtcctggtcgaggaacgcggcctg
aagcaggtcaccgacaccggcgccatcgaggcggcggtggacgcggtgatcagcgccaat
ccggacaaggtccagcaggtcaaggacggcaagaccgccctgctcggctggttcaccggc
caggtgatgaagtccacccagggcaaggccaacccggccatggtcaacgagatgttgtcc
aagaagatcctggggtag

DBGET integrated database retrieval system