KEGG   Magnetospirillum magneticum: amb1591Help
Entry
amb1591           CDS       T00305                                 

Definition
(GenBank) Enoyl-acyl-carrier-protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00061  Fatty acid biosynthesis
mag00780  Biotin metabolism
mag01100  Metabolic pathways
mag01130  Biosynthesis of antibiotics
mag01212  Fatty acid metabolism
Module
mag_M00083  Fatty acid biosynthesis, elongation
mag_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    amb1591
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    amb1591
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    amb1591
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mag01004]
    amb1591
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     amb1591
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     amb1591
Lipid biosynthesis proteins [BR:mag01004]
 Fatty acid synthase
  Component type
   amb1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAE50395
UniProt: Q2W6Y0
LinkDB All DBs
Position
complement(1720411..1721295)
Genome map
AA seq 294 aa AA seqDB search
MYVGEPWPVSAPPIRSPRNEDRMTAPAPLMAGKKGLVMGVANDRSIAWGIAQAARAQGAE
LAFTYQGEALEKRVRPLAQSVGSDIVLPCDVSDEASIDAVFAELEKRWGKLDFVVHAIGY
SDKNELRGRYADTSLQNFLTSMHISVFSFTSVARRASAMMPDGGSLLTLTYYGAERVMPH
YNVMGVAKAALEASVRYLAVDLGGQGIRVNSLSAGPIKTLAASGIGDFRYILKWNEYNSP
LKRNVTLEDIGGAGLYLLSGLSSGVSGETHHVDCGYHVVGMKAVDAPDITVAKD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgtaggggagccgtggcccgtttcggcgccacccatccgctcaccacgaaacgag
gaccgcatgaccgctcccgctcccctgatggccggcaagaagggccttgtcatgggcgtc
gccaacgatcgctccatcgcctggggcatcgcgcaggctgcccgcgcccagggtgccgaa
ctggccttcacctatcagggcgaggccttggaaaagcgggtccgccccctggcccagagc
gtcggctcggacatcgtgctgccctgcgacgtgtcggacgaggcctccatcgacgccgtc
ttcgccgagttggaaaagcgctggggcaagctggacttcgtggtccatgccatcggctat
tccgacaagaacgagctgcgcggccgctatgccgacacgtccttgcagaacttcctgacc
tccatgcacatctcggtgttctcgttcacctcggtggcgcgccgggcctcggccatgatg
cccgacggcggctcgctgctgacgctgacctattacggcgccgagcgcgtgatgccccat
tacaacgtcatgggcgtcgccaaggcggctctcgaagcctcggtgcgctatctcgccgtc
gatctcggcggccagggcatccgcgtcaactcgctgtcggccggtcccatcaagactctg
gcggcgtccggcatcggcgacttccgctacatcctgaagtggaacgagtacaacagcccg
ctcaagcgcaacgtcaccctggaagacatcggcggcgccggcctttacctgctgtccggc
ctgtcgtcgggcgtgtcgggcgagacccatcatgtggattgcggctatcacgtggtcggc
atgaaggcggtggacgcccccgacatcaccgtcgccaaggactga

DBGET integrated database retrieval system