KEGG   Magnetospirillum magneticum: amb2511Help
Entry
amb2511           CDS       T00305                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mag  Magnetospirillum magneticum
Brite
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     amb2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAE51315
UniProt: Q2W4B0
LinkDB All DBs
Position
2692957..2693553
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPFAIDALEPHISARTFEFHHGKHHAAYVTNLNNLTKDTDLASKSLEEVIKVA
AADLPAKQGIFNNAAQVWNHTFFWNCLKKGGGGKPGAKLLAKIEADLGGFDKFKEDFKAA
AVGQFGSGWAWLVLDGGKLKITKTANADLPLAHGQKALLTVDVWEHAYYLDWQNRRPDFV
QCFLDNLVNWDFVEANLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgagcttccgcccctccccttcgccattgatgcgctggagccccacatttcc
gcccgcacgttcgagtttcatcacggcaagcaccacgccgcctatgtgaccaacctcaac
aacctgaccaaggacaccgatctggcgtccaagtccctggaagaggtgatcaaggtggcc
gccgccgatctgccggccaagcaaggcattttcaataacgccgcccaggtgtggaaccac
accttcttctggaactgcctgaagaagggcggcggcggcaagccgggcgccaagctgctg
gccaagatcgaggccgatctgggcggcttcgacaagttcaaggaagacttcaaggccgct
gccgtcggccagttcggctcgggctgggcctggctggtgctggatggcggcaagctgaag
atcaccaagaccgccaatgccgacctgcccctggcccacggccagaaggcgctgctgacc
gtcgacgtgtgggaacacgcctattacctcgactggcagaaccgccgccccgatttcgtc
cagtgcttcctggacaatctggtgaactgggacttcgtggaagccaatctcggctaa

DBGET integrated database retrieval system