KEGG   Magnetospirillum magneticum: amb2796Help
Entry
amb2796           CDS       T00305                                 

Definition
(GenBank) Predicted transcriptional regulator
Organism
mag  Magnetospirillum magneticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_11 WYL GST_N GST_N_3 GST_N_2 GST_C_2 HTH_IclR GST_C
Motif
Other DBs
NCBI-ProteinID: BAE51600
UniProt: Q2W3H5
LinkDB All DBs
Position
2985116..2986504
Genome map
AA seq 462 aa AA seqDB search
MVYGVPMSRTDRLFGLLQSLRRHRRPVSGADLAAEAGISLRTLYRDVATLQGLGAEIDGE
PGLGYVLKPGFLMPPLMFSDEEIQALALGARWVARRTDADLARAARNAMAKIASVVPPDL
HRKLDDDALIIGPGWEKPQAVGLDTLRQALNHERKLALSYRDEKGVRTERVVWPVVLGFF
ETTRVLAAWCELRGGFRHFRTDRIEAAELLSYRPPRPRRSLMAEWRKTMLTETDSSRAYK
SSPPKPRTETPMSKDLIFYTHPQSRGNIVHWMLEEIGGPYRIEVKEYGTTMKAPDYLAIN
PMGKVPAIRHGDTVVTESAAIVAYLADAFPEAGLAPPLAERGEYYRWLFFTAGCGEPAIS
NHSVGWDPTTPDLQGRFGYGSFPLVMDTLSQAVRGKRFVAGDRFSAADVYLGSLLHWAMR
FGIIDRRPEFETYCEGLISRPAALRAREQAEKLASQHAWTTS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtctatggtgttcccatgtcgcgcaccgatcgcctgttcggccttctgcaatccctg
cggcgccaccggcggccggtgagcggggcggatcttgccgccgaagccggcatttccctg
cgcaccctttaccgggacgtggccacgctccagggtttgggcgcggaaatcgacggcgag
cccggcctcggctatgtgctgaagcccggctttctgatgccgccgctgatgttttccgat
gaggaaatccaggccctggccctgggggcgcgctgggtggcgcgccgcaccgacgccgac
ctcgcccgagcagcccgcaacgccatggcgaaaatcgcttcggtcgtcccgccggatctg
catcgcaagctggacgacgacgccctgatcatcggcccgggctgggaaaagccccaggcg
gtcgggcttgatacgcttcggcaggccctgaaccacgagcgcaagctggcgctgtcctac
cgcgatgaaaaaggggtacggaccgaacgggtggtctggccggtggtcctgggctttttc
gaaacgacccgcgtcctggcggcatggtgcgagctccgcggcggctttcgccacttccgc
accgaccgcattgaggcggcggagcttctgtcctaccgcccgccccgtccccgtcgctcc
ctgatggccgaatggcgcaaaaccatgctgacagaaactgacagcagcagggcctacaaa
tcctctccgccgaaaccgcgcacggagacacccatgagcaaagacctgattttctatacc
cacccgcaatctcgcggcaacatcgtgcactggatgctggaagagatcggcggcccctac
cgtatcgaggtcaaggaatacggcaccaccatgaaggcgcccgactacctggccatcaat
cccatgggcaaggtgccggccattcgccacggcgacaccgtggtgacggaatccgccgcc
atcgtcgcctatctggccgatgccttccccgaggcgggactggccccgcccttggcggag
agaggcgagtattaccgctggctgttcttcaccgcgggctgcggcgagccggccatcagc
aatcattccgtcggctgggacccgaccacgccggacttgcagggacgcttcggctacggc
tcgttcccgctggtcatggacaccctgtcccaggcggtccggggcaagcgcttcgtcgcc
ggcgaccgcttcagcgccgccgatgtctacctgggcagcctgctgcactgggccatgcgg
ttcggaatcatcgaccggcggcccgagttcgagacctattgcgaaggcctgatcagccgc
ccggcggcgttgcgagcccgggagcaggcggaaaagctcgccagccagcatgcctggacc
acaagctga

DBGET integrated database retrieval system