KEGG   Magnetospirillum magneticum: amb2922Help
Entry
amb2922           CDS       T00305                                 

Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00030  Pentose phosphate pathway
mag01100  Metabolic pathways
mag01120  Microbial metabolism in diverse environments
mag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    amb2922
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     amb2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAE51726
UniProt: Q2W349
LinkDB All DBs
Position
3115682..3117532
Genome map
AA seq 616 aa AA seqDB search
MSWTGKFLRIDLTNGSVKTEELNRAWARQYLGQRGLATKYFAEEVDPKVDPLSPANKMIF
TTGPLTGTAASTGGRYSVVTKGPLTNCIACSNSGGFFGNELKNAGWDMIIVEGRSPKPVY
LSIENETVEIRDAAEFWGKTVWETENGLKARHQDPMLRVATIGAAGEKGVLYACIVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTRGVTVKDPDRFIKATIEQKKVLADNAVTGQGLPKY
GTQVLMNVINEIGAMPTRNFKEVQFEGAHKISAEAMHEPRATDGKANLATNGACFGCTIA
CGRISRMDPGHFSITSRPQYKEPSGGVEYEAAWAMGSDCGVDDLEACTFANFMCNEHGID
PISFGSTLAAAMEMFEMGVITKEQTGGVELKFGSAEALVKMAELTGKGEGFGLELGQGSR
RLCAKYGHPELSMTVKSQEFPAYDPRGIQGMGLTYATSNRGACHLRSYTVASEVLGIPFK
SDPLATDGKAALVKAFQDATAAFDASGICIFTTFAWSLENLAPQIDAACEGEWTPEILLE
VGERIWTLERQFNLAAGMTAADDTLPKRLLKDAAKTGPAKGLTSGLEKMLPEYYQLRGWT
TDGVPTTETLKRLQLA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagctggactggcaagtttctccgtatcgatctcaccaatggcagcgtcaagaccgag
gaactgaaccgcgcctgggcgcggcagtatctggggcagcgcggcctggccaccaagtat
ttcgccgaggaggtcgaccccaaggtcgatcccctgtcgcccgccaacaagatgatcttc
accaccgggccgctgaccggaaccgccgcctctaccggcgggcgctattccgtggtgacc
aaggggccgctgaccaactgcatcgcctgctccaattccggcggcttcttcggcaatgag
ctgaagaacgccggctgggacatgatcatcgtggaaggcaggtcgcccaagcccgtctac
ctttccatcgagaacgagacggtggaaatccgcgacgccgccgaattctggggcaagacg
gtgtgggagacggagaacggcctgaaggcccggcatcaggaccccatgctgcgcgtcgcc
accatcggcgccgccggcgagaagggcgtgctgtatgcctgcatcgtcaacgacctgcac
cgcgccgccgggcgttcgggcgtgggcgcggtgatggggtccaagaacctcaaggccatc
gcggtgcgcggcaccaggggcgtgacggtcaaggaccccgaccgcttcatcaaggccacc
atcgagcagaagaaggtgctggccgacaacgccgtcaccggccagggcctgcccaaatac
ggcacccaggtgctgatgaacgtcatcaacgagatcggcgccatgccgacgcggaacttc
aaggaagtgcagttcgagggcgcccataagatctcggccgaggccatgcacgagccgcgc
gccaccgatggcaaggccaacctggccaccaatggcgcctgtttcggctgcaccatcgcc
tgcggccgtatctcgcgcatggaccccggccacttctccatcacctcccggccccagtac
aaggagccctcgggcggcgtggaatacgaggccgcctgggccatgggatcggattgcggc
gtcgacgacctggaggcctgcaccttcgccaacttcatgtgcaacgagcacggcatcgac
cccatctccttcggctcgaccctggcggcggccatggaaatgtttgagatgggcgtcatc
accaaggagcagaccggcggcgtcgaactgaaattcggctcggccgaggccctggtgaag
atggcggaactgaccggcaagggcgagggcttcggcctggaactgggccagggctcgcgc
cggctgtgcgccaaatacggccaccccgaactgtccatgacggtcaagagccaggaattc
cccgcctatgatccgcgcggcatccagggcatgggcctgacctacgccacctccaaccgt
ggtgcctgtcacctgcgctcctacaccgtggcgtcggaagtgctgggcatcccgttcaag
agcgatcccctggccaccgatggcaaggccgccctggtcaaggcgtttcaggacgccacg
gcggcgttcgacgcctcgggcatctgcatcttcaccaccttcgcctggagcctggagaat
ctggcgccccagatcgacgccgcctgcgagggcgagtggacccccgaaatccttctcgag
gtgggcgagcgcatctggaccctggaacgccagttcaatctggcggccggcatgacggcg
gcggacgacaccttgcccaagcgcctgctgaaggacgcggccaagaccggcccggccaag
gggctgacctcgggcctagaaaagatgctgccggaatattaccagttgcgcggctggacc
acggacggcgtgcccaccaccgagaccctgaagcgcctgcaactggcctga

DBGET integrated database retrieval system